KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_0229Help
Entry
HMPREF9228_0229   CDS       T01844                                 

Definition
(GenBank) hypothetical protein
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AEF27751
Position
complement(287560..287874)
Genome map
AA seq 104 aa AA seqDB search
MSDDADPWALPEKTQDLQGLTAGEPTSELARRQDGTSENTTYHLATGKADDSVTDIDSWK
THLPPYATNRRYHQLNATQLNELIDKGGLWTSKAKQEMRHRNYR
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
ttgtccgacgacgccgatccgtgggcattaccagagaaaacgcaagatctgcaaggactt
acggcaggcgaaccgacatctgaactggcaagacggcaagatggcaccagcgagaacacc
acctatcatcttgcaacaggtaaagccgacgattccgtcacagacattgacagctggaag
acgcacctacctccctacgcaacaaaccggcgctaccatcagctcaatgccacgcaattg
aatgaactcatcgacaaaggaggtctatggaccagcaaagccaaacaggagatgcggcac
cgcaattacagatag

DBGET integrated database retrieval system