KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_0230Help
Entry
HMPREF9228_0230   CDS       T01844                                 

Definition
(GenBank) hypothetical protein
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_25 DnaB_C ATPase RecA Elf1 AAA_22 Zn_Tnp_IS1595 AAA_16 TIP49
Motif
Other DBs
NCBI-ProteinID: AEF26800
Position
complement(288160..290331)
Genome map
AA seq 723 aa AA seqDB search
METSYEQVLEAVRRYPRDLKLQELPRDTSGRQHAQCSCPAHDGDGGTSLHITYDQSDGKT
MLHCFGAEHCDAAAIADALGLKIIDLFDQQSGPQGHAGYSSYNSYSCDSRLTAADLASIR
HANAPLLNRNETTTITPTHTENSAEIRQQYAMPKPYLEPLVLGQSPMFAAICAAIAVQPN
IGLLHGTCPNCGTADSLTVLYSPLESATLLRCSTCQADDVLNALNAPATLARSNGYEAMI
YDSERGTAYEYADGLIVRRSPAKRISQSGNTADKHPLWMAADAKRAVALGKPVYLTEGEK
DAGTLRALDYAAVTAAGGGGNFATKLDLDSARLALSGADVVAIVDKDDTGARWKEQVAQT
LTPFVRSLTFIQAAGEAHDASDAAMSGVEFEILPRESIQHESELEPELMSRAYSLTRLAD
VEPERPLWLWPGHIPKGKIVLIDGDPATGKSTLALDIAAHVTTGAAWPDGSAGCEPANVL
LLTAEDGLADTVSPRIRAAQGDTSKMFALSEVFKDGKEVAITLTDALPQIAQAVREQHIG
LIVVDVLISFLGSDTNSYKDQDIRAQVMAPLKRLCEETGCTVIALRHLNKGQGAAIYRGG
GSIGIIGAARAAFLVAKDPENEERRLFAPVKFNLGPMPRAMAYRLEDNPLLGCAHVHWLG
ETDDTAESHNQSAYGPSEREDSDVRTFIQDYFDHNKELTPDGLYWGVPSYRVINEAKGEF
SKQ
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atggagacctcatatgagcaagtgctcgaagcagtgagacgctatccgcgagatctcaag
cttcaagagcttccgcgcgacacctccggaagacaacatgcacagtgcagctgcccagcc
catgacggagacggcggcacttcgctgcacatcacctacgaccagtccgacggcaaaacc
atgctgcactgcttcggagcggaacactgcgatgccgctgccattgccgatgcactggga
ttgaaaatcatcgacctgttcgaccaacaaagcggacctcaaggccatgccggttacagc
agctacaacagttacagctgcgatagccggctcactgccgccgatttggcgtccatacgg
catgcgaatgctccacttctcaacagaaatgagacaacgacgattacacctacgcacacg
gaaaactctgcggaaatcagacaacagtacgcgatgcccaaaccgtacttggaaccattg
gtcttaggccaatcccctatgttcgccgccatctgcgcagctattgcagttcagccaaat
atcggcctgttgcacggcacttgcccaaactgcggcacagccgactcgctcactgtgctg
tattccccgctggaaagcgccacattgctccggtgcagcacttgccaagccgacgatgta
ctcaacgcactgaacgctcccgctacgctggctcgttccaatggctatgaagcaatgatc
tacgacagcgagcgcggcacagcatacgaatatgcggacggtctgattgtccgccgctca
ccggccaagcgaatctcacaaagcggcaacaccgccgacaagcacccattgtggatggcc
gccgacgcgaaacgtgccgtggcattgggcaagccagtgtatctgacggagggagaaaaa
gatgccggcacattgcgagcgctcgactatgccgctgtaaccgcagcgggaggtggcggc
aacttcgccacgaagctggatctcgattcggctcgcttagcccttagtggggctgatgtg
gttgccattgtggataaggacgacactggcgctcgctggaaggagcaagtggcgcagacg
ctgacgccgttcgtgcgatcactgacttttatccaagcagctggcgaggctcacgatgct
tccgacgctgcgatgagcggcgtggaattcgagattctgccaagagaaagtatccagcat
gagtctgagctcgagcctgagctgatgtcccgcgcctattcgctgacccgtttggctgat
gtggaaccggagcgaccgttgtggttgtggccgggccacattcccaaggggaagatcgta
ctgattgacggcgatccggcgactggcaaaagcactttggccttggatattgcagctcac
gtcaccacgggagcagcatggccggatgggtccgctggatgcgagcctgcgaacgtgctg
ctgttgactgcggaagacggactggcggacaccgtgagcccacgcattcgcgccgcacaa
ggcgacacatccaagatgttcgccctatcggaggtcttcaaggatggcaaggaggtagcg
attacgctcaccgacgcactgccacagatagcacaggctgtgcgtgagcagcatatcggc
ctgattgtcgtggatgtgctgatatcgtttttgggcagcgacaccaacagctacaaggat
caggatattcgcgcacaggtgatggctccgctcaagcggctgtgtgaggaaaccggctgc
acagttatcgcgctacgccatctcaacaaagggcagggagcggcgatctaccgtggaggc
ggcagcatcggcatcatcggcgcagcacgagccgcttttctggtggcgaaggatccggag
aatgaggaacggcgactgttcgcaccggtcaagttcaatctggggccaatgccacgagcc
atggcctaccggttggaggataatccgctgcttggctgcgcacatgtccactggctgggc
gaaacggacgatacggcggaatcgcacaaccagagtgcttacggccccagcgaacgtgag
gatagtgacgtgcgtacgttcatccaagactacttcgaccacaacaaggagctcacaccg
gatggcttgtattggggtgtgccgtcgtacagagtaatcaacgaagcgaaaggcgagttc
agcaagcagtaa

DBGET integrated database retrieval system