KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_0234Help
Entry
HMPREF9228_0234   CDS       T01844                                 

Definition
(GenBank) hypothetical protein
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11
Motif
Other DBs
NCBI-ProteinID: AEF28107
Position
complement(293444..293593)
Genome map
AA seq 49 aa AA seqDB search
MGSVHPHRAREGIGNVRVVFSNCVQFSGLRTGATNHAKPSLTANTSIAQ
NT seq 150 nt NT seq  +upstreamnt  +downstreamnt
atgggcagcgtccacccgcatcgcgcgcgcgaaggaatcggcaacgtgcgtgtcgtgttc
tcgaattgtgttcagttcagcggactgcgcacaggcgcgacgaaccatgctaaaccctct
ctcactgcaaatacctcaatagctcaatag

DBGET integrated database retrieval system