KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_0235Help
Entry
HMPREF9228_0235   CDS       T01844                                 

Definition
(GenBank) iron permease FTR1 family
  KO
K07243  high-affinity iron transporter
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
Brite
Transporters [BR:bbv02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   HMPREF9228_0235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTR1 TBPIP GrpE HalX DUF3450
Motif
Other DBs
NCBI-ProteinID: AEF27254
Position
293624..295402
Genome map
AA seq 592 aa AA seqDB search
MAAVVFLFALIAATFLPAAVIPQSAFADTPTATMVTAADKTDTSGVEYTTWADVSKAIEA
QLQEGAKEYKSGNTAGSTSAFMSAYNTIYIASNFTAVVRDTISSDKQTAQQQAFQDIQNL
SYTAGNDDQLTQKIDALSADLDATAQQLDANTQLAKPKQYNENLQKQIAKERKELDAKKK
RTKNTAKTWKDVADAMLPILDNAYKAYEGGDAAKGATLVNDAYYQHYEKLGFEKTVLSAI
SGNRVSQVEYQFKLCRSSMNTGKSTSEVKKYVEDLKNMLTTDAAKLDGGAADQEGGFLKF
ITSSVGQAFLILIREGLEALLVVAAVVAYLVKSGNKRFTKWIYVGVLAGLAGAGVVAIIF
MVAFGGSGPLQEIMEGVCALIAMCMLLWTSNWMLNKSSVEAWNRYIKGKTEAAVASVSSQ
VEAGEKVASRTVVSLAMLSFLAVFREGAETVIFYQSIYTMSQDTHGMVVGALAAAVVLVI
IFLVIRFTSVKIPIGPFFLVTSILMSVLVVVFAGGGVHALIEGDLLPANYLPGMPTNDWL
GFYPYVECIIAQVLAAIAVIALFAVGFIKQRKAKAQFAAAPDAKASEAVAQA
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atggctgccgtcgtgttcctgttcgcattgattgccgcgaccttccttcccgccgcagtc
atcccgcagtctgccttcgcggatacgccaacggccacgatggttaccgcagccgataag
acggacaccagcggcgttgagtacacgacctgggccgacgtgtccaaggccatcgaggcg
cagctgcaagaaggcgccaaagaatataagtccggcaacactgccggctccacgtccgcg
tttatgtccgcgtacaacactatctacatcgcctccaacttcaccgccgtggtgcgtgac
accattagctcggataagcagaccgcccagcagcaggctttccaagacatacagaacctc
tcttacacggccggcaacgatgatcagctcacccaaaaaatcgacgccctgagcgccgac
ctcgacgccactgcccagcagctcgacgccaatacccagctcgccaagccgaagcagtac
aacgagaatctccagaagcagatcgccaaggagcgcaaggaactcgacgccaagaagaag
cgcaccaagaacacggccaagacttggaaagacgtcgcagacgcgatgcttccgattctg
gacaatgcatacaaggcctatgaaggcggcgacgctgccaagggcgccacgcttgtgaat
gacgcctactaccagcactacgaaaagctcggtttcgagaagaccgtgctgagcgccatc
agtggcaaccgcgtctcccaggtggaataccagttcaagctgtgccgctcctcgatgaac
accggcaagtcgacctctgaagtcaagaagtacgtcgaagacctgaagaacatgctgacc
accgatgccgccaagctcgacggtggcgctgccgatcaggagggcggattcctcaagttc
atcaccagctcggtcggccaagcattcctgattcttatccgtgagggtctcgaagccctg
ctcgtggtcgccgccgtggtggcctacctcgtcaagtccggcaacaagcgcttcaccaag
tggatctacgtgggcgtgctcgccggtctggccggcgcaggcgtggtggcaatcatcttc
atggtcgcgttcggtggctccggcccgctgcaggagatcatggagggcgtgtgcgcgctc
atcgccatgtgcatgctgctgtggaccagcaactggatgctcaacaagtcctcggtcgag
gcctggaaccgctacatcaagggaaagaccgaagccgcagtggcgtccgtctcctcgcag
gtcgaggccggcgagaaggtggcttcccgtacggtggtctcgctcgccatgttgagcttc
ctcgccgtgttccgcgagggcgccgaaaccgtgatcttctaccagtccatctacacgatg
agccaggatacgcacggcatggtggtcggtgcactcgccgccgccgtggttctcgtgatt
atcttcctggtgattcgcttcacctccgtgaagattccgattggcccgttcttcttggtc
acttcgatcttgatgtccgtgctggtggtcgtcttcgccggcggcggtgtgcatgcgctg
atcgagggtgacctgctgcccgccaactacttgccgggcatgcccaccaacgattggctt
ggcttctacccgtatgttgaatgcatcatcgcgcaggtgctggcggccatcgccgtcatc
gcgctgttcgcggtcggattcatcaaacagcgcaaagccaaggctcaattcgccgccgcc
ccggatgcgaaggccagcgaggctgtcgctcaggcgtaa

DBGET integrated database retrieval system