KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_0236Help
Entry
HMPREF9228_0236   CDS       T01844                                 

Definition
(GenBank) hypothetical protein
  KO
K07230  periplasmic iron binding protein
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
Brite
Transporters [BR:bbv02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   HMPREF9228_0236
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iron_transport
Motif
Other DBs
NCBI-ProteinID: AEF28124
Position
295518..296213
Genome map
AA seq 231 aa AA seqDB search
MMKNKKLAALLGVLLAGSMAVSMAACGSSNNASDTKASTSSSDTAKKDDSAKADAPSDTA
GFEEVPVGPSGTAEEQDKPAGPLTVGAVYFQPIDMEPASSGLKAADASFHLEADIHASQE
GTDYGYGKGDFVPDLTVNYTIIDKSTGKEVEGGKATSGTFMQMNASDGPHYGANVKLDKA
GTYQLKLSIESPASKGWMLHVDPETGVKNHQFWTEPIEVTFDNWDYTPRQW
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagaacaagaagcttgccgctctgctcggtgtgctgctcgccggctccatggct
gtttcgatggctgcttgcggttcgtccaacaacgcttccgacaccaaggcgtctaccagc
tcctccgacaccgccaagaaggacgattcagccaaggctgatgccccgagcgataccgct
ggctttgaagaggttccggttggtccttccggcaccgctgaggagcaggataagcctgcc
ggcccgctgaccgtgggcgctgtctacttccagccgatcgacatggagcccgcctcctcc
ggtctgaaggccgccgatgcgagcttccacctggaagccgacatccacgcctcccaggaa
ggcaccgactacggctacggcaagggcgacttcgttcctgacctgaccgtgaactacacc
atcatcgacaagtccaccggcaaggaggtcgagggcggcaaggccacctccggtaccttc
atgcagatgaacgcctccgatggcccgcactacggcgccaacgtcaagctcgacaaggct
ggcacctaccagctcaagctctccatcgagtccccggcctccaagggctggatgctgcac
gtcgacccggagaccggtgtgaagaaccaccagttctggaccgagccgatcgaggtcacc
ttcgacaactgggactacaccccgcgtcagtggtga

DBGET integrated database retrieval system