KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_0308Help
Entry
HMPREF9228_0308   CDS       T01844                                 

Definition
alpha-galactosidase domain protein
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:bbv00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    HMPREF9228_0308
  Lipid metabolism
   00561 Glycerolipid metabolism
    HMPREF9228_0308
   00600 Sphingolipid metabolism
    HMPREF9228_0308
Enzymes [BR:bbv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     HMPREF9228_0308
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
377457..379259
Genome map
AA seq 600 aa AA seqDB search
MLLDHFKDMLYEGQSLGATWIMHSDGLTIEATCEDGPASTGIVFDVTAANPGATATIVIG
KPLGSIQRFHMVGSRCREPLPADWAGVTQVSLVNSAPMGCMVDDADRNVLSFAYSFAQDE
ITMRYGVDEEHVLFVVMLQIQRVPGHSRLLLMDDGLPLDETMRLLVEWVADGSAPLPMAD
KALEPVFSTWYAYLQNVDAETLGRELDGMSRLGCGSIFIDDGWQQYGSGRGYSGCGDWVP
DPVKFPDMRATVRRFQDAGVGVVLWIAPLLLGEKAHVFKTLERYAPIHDDGLGRQFHVLD
PRRKAVRDYIGGVCARMAKDYGIAGLKIDFLEQAGAYQGQPLENPEPGDVTDVGEAMRLM
LGRIKTMLIENCGQVPVVEFRQPYSSPVIAPYSNIVRASDCPADALTNRIRTIDERLAAG
NRVVHGDMLLWDVNAGAETCAAQILASFFAVPQISVPPSAMSNGQYESCRFLLSLWRKHR
NVLLNGRLQPVSSILGYPLVHAFDGNGTQVSGVYAPDMIIDVDADTRTLIILNASTENNV
TIRLRGDGGTVKLTGHAYDCTGAITMQFEEDTDTFRENGDATITTIPVPTYGILELALER
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgcttttggatcatttcaaggacatgctgtatgaggggcaaagcctcggcgcgacgtgg
atcatgcattcggacgggctgaccatcgaggcgacgtgtgaagatggtccggcatcgacg
ggcatcgtgttcgatgtgacggcggcgaatccgggggccactgcgacgatcgtgatcggc
aagcctctcggctccatccagaggtttcacatggtcggatcccgttgccgcgagccgttg
cctgctgactgggccggcgtcacgcaggtgtcgttggtcaattcggcccccatgggatgc
atggttgacgatgcggacaggaacgtgctgtcattcgcatattcgttcgcacaggacgag
attacgatgcgttacggcgtcgacgaggaacacgtgttgttcgtcgtgatgctgcagatc
caacgtgttcccggacatagccgactgttactcatggatgacggactgccgttggatgag
acgatgcggctcttggtcgaatgggtggccgatggttccgcacctttacccatggcggac
aaggcgctggaaccggttttttccacctggtatgcgtacctgcagaacgtcgacgccgag
accttgggacgtgagctcgacggcatgagccgactgggatgtggatccatattcatcgac
gacggctggcagcaatatggcagcgggcgcggatattccggttgcggcgactgggttccc
gatcccgttaaattccccgacatgcgtgccactgtcaggaggttccaggacgcgggggtc
ggcgtcgtcctatggatcgcacccctgttgctgggcgagaaggcgcacgtgttcaagacg
ttggaacgatacgcgcccatccatgacgacgggctgggacggcaattccacgtcctcgac
ccacgacgcaaggcggtccgcgactacatcggcggcgtttgcgctcggatggccaaggat
tacggcatcgccggactgaagatcgatttcctggaacaggccggggcctaccaaggccag
ccattggagaatcccgaacccggcgacgtcaccgatgtcggcgaggcgatgagacttatg
ctcggacggatcaagaccatgttgatcgaaaactgcggtcaggtcccggtcgtcgaattc
cgccaaccctattccagtcccgtcatcgcaccgtacagcaacatagtcagggccagcgac
tgtcccgccgatgccctgaccaatcgaatccgcaccatcgacgaacggctggccgctggt
aaccgcgtggtgcacggagatatgctgctgtgggacgtgaacgcgggagcggagacgtgc
gcggcgcagattctcgcatcattcttcgccgtgccgcagatctcggtcccgccgtcggcc
atgtcgaatggtcagtatgaatcctgccgtttcctactgtccctatggcgcaaacaccga
aacgtcctgttgaatggccgtctgcagccagtgtcaagcattctgggctatccactcgtg
cacgcgttcgacggcaacgggacgcaagtcagcggcgtgtacgcgccggacatgatcatc
gacgtggacgcggatacgagaacgctgatcatcctcaacgcatccacggaaaacaacgtg
accattcgcctgcgcggtgacggcgggacggtcaagttgaccggccacgcatacgactgc
acaggagccatcactatgcagtttgaagaagatacagatacgttccgtgaaaacggagac
gcgacgatcacgacgattccagttcccacctatggcatattggaattggcgctagagcga
taa

DBGET integrated database retrieval system