KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_0438Help
Entry
HMPREF9228_0438   CDS       T01844                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bbv00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
520694..522826
Genome map
AA seq 710 aa AA seqDB search
MTTRRAFRWPSLLTESGRGIAFGGDYNPDQWPEETLNEDIRLMGEAGVNVVSLAIFSWDK
IEPVEGAFTFEWLDHVIDRLGKAGIAVDLASATATAPLWLYESHPEVLPVDRYGHIVNAG
SRQSWQPTSPVFKEYALRLCRKLAEHYKDNPYVTAWHMGNEYGWNNRYDYSDNALAAFRT
WCEAKYGTIDALNEAWGTAFWSQHVNSFDEVLLPRHMGGDAMVNPPQQLDYERFGNDMLL
DFYKAERDAIEQICPGKPFTTNFMVSTDQCVMDYAKWAGEVDFVSNDHYFHEGESHLDEL
ACSDALMDSLALGKPWYVMEHSTSAVQWKPLNARKRAGELMRDSLAHVAMGADAICFFQW
RQSKSGAEAFHSAMLPHAGADSKVFRGVCELGKALKTLSDAGLQGTELERAGTAILFSAE
SEWATRSETLPSMKLNHWHDVRDWYRGFLDAGLRADVVPLAYDWTDYKTIVLPTVLSLSD
EDVRRIADFAKAGGTVIVGYATGLVDEYFHIGLGGYPGAGNGLLRDMLGIRSEEFNILGE
EAEGEPSEISLSNGLTTRLWQNDVTSVAADTTVLASYTGESAADWELERTPAITSHPYGN
GTAIYVGCDLNRHDIAQLLKALGSRWRELSAQPTEGGQTPTYPTTDPRILHTIRRSADGS
TRFDFYLNRSNQPVAINGVEGDPIIVHRCETDAVGYTLNRNAILIAKTSC
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atgactactcgtagagcatttaggtggccgtccctgctgacggaatccggccgcggcatc
gcgttcggcggcgactacaacccggaccagtggcccgaggagacgttgaacgaggatatc
cgtctcatgggtgaggccggcgtgaacgtcgtatcgctggcaatcttcagctgggacaag
atcgagccggtcgagggcgcgttcacgttcgagtggctcgaccatgtgatcgacaggctc
ggcaaagccggcatcgccgtggacttggcctccgccaccgccaccgcgccgctgtggctg
tacgaatcccatccagaggtgctgccggtagaccggtatggtcatatcgtcaacgcgggc
tcacgccagtcgtggcagcccacaagcccggtgttcaaggaatacgcgctgcgcctgtgc
cgcaaacttgccgaacactacaaggacaacccgtatgtgaccgcttggcacatgggcaac
gaatacggctggaacaaccgctacgactactccgacaacgccttggccgcgttccgcacg
tggtgcgaggccaagtacggtaccatcgacgcgttgaacgaggcgtggggcacggccttc
tggtcgcagcacgtgaacagtttcgacgaggtgttgctgccgcgtcacatgggcggcgat
gccatggtcaacccgccgcagcagctcgactatgagcggttcggcaacgacatgctgctc
gacttctacaaggccgaacgtgacgccatcgagcagatctgccccggcaagccgttcacc
acgaacttcatggtctccaccgaccagtgcgtcatggactacgccaaatgggccggcgag
gtggacttcgtgtccaacgaccactacttccatgaaggcgaatcccacctggacgagctc
gcctgctcggacgcgctcatggactccctcgcgctgggcaagccgtggtacgtgatggag
cactccacctcagccgtgcagtggaagccgctcaacgcgcgcaaacgggccggcgagctc
atgcgcgactccctggcccacgtggccatgggcgccgacgccatctgttttttccaatgg
aggcaatccaagtcgggcgctgaggcgttccactccgccatgctgccccacgcgggcgcc
gattccaaggtcttccgcggcgtatgcgagctcggcaaggcgctgaagaccctctccgac
gccgggctgcagggcactgagctcgagcgtgccggcacggcgatcctgttcagcgcggaa
tccgaatgggccacacgctccgaaaccctgcccagcatgaaactcaaccattggcacgac
gttcgcgactggtaccgcggcttcctggatgccgggctgcgcgcggacgtggtgccgctc
gcctacgactggactgactacaaaaccatcgtgctgcccaccgtgctcagcctgtccgac
gaagacgttcgccgtatcgccgacttcgcgaaggccggcggaaccgtcatcgtcggctac
gccactggcctggtcgacgagtacttccacatcgggctcggcggatacccaggtgccggc
aatggcctcctacgcgacatgctcggcatccgcagcgaagaattcaacatcctcggtgaa
gaagccgaaggcgagcccagcgaaattagcctgtccaacggtctgacgacccgcctgtgg
cagaacgacgtgacttccgtagccgcggacaccacagtgctcgcctcttacacaggtgag
tccgccgccgactgggagctggagcgcacccccgccatcaccagccacccctatggcaac
ggtaccgccatctacgtgggctgcgacctcaaccgtcacgacattgcccagctgctcaaa
gcacttggctcccgctggcgggagctgtcggcgcagccgactgagggtggtcaaactcca
acctatcccaccacagatccccgcatcctgcacaccatccgccgatccgcagacggctcc
acccgcttcgatttctacctcaaccgctcaaaccagcccgtcgccatcaacggtgtggaa
ggtgatcccatcatcgtccaccgttgcgagactgacgccgttggatatacgctgaaccgc
aacgccattcttatcgctaaaacgtcctgctaa

DBGET integrated database retrieval system