KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_0631Help
Entry
HMPREF9228_0631   CDS       T01844                                 

Gene name
murE
Definition
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.-)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:bbv00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:bbv00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(752098..753645)
Genome map
AA seq 515 aa AA seqDB search
MALTLAAAAELLDRHHLLREIIQGDCWTDDAADLAGADEPFTAITYDTRKVVPGTLLCCK
GRFKAEYLTDIDTTGLAAYVAETEYSAVTRTPGLIVNDARKAMSLLSAEFYGRPQDELTV
IGITGTKGKTTTAYFVQAVLNAYSGGRAALFSSVDNCLDGHTYAESDLTTPESMDAFRMM
REAANNGMRYLVMEVSSQAYKVERVYGLTFDAGAFLNISPDHISAIEHPTFEDYLYCKRQ
ITHNCRTLVLGADCDHADLIRQDAQASNVPVTTFALHAADGHGTHADFVALPDASSGYLF
QEQGKAIGDFSLELEGEFNAANAAAAIALSRAVGVPAGSEAFRALERVHIPGRMEHYESG
NMVAYVDYAHNYVSTKTLAEFVTHKYADRNPRVVVVTGSVGDKAVDRREGIIKGAQDYAD
RIILTAEDTVHERMIDILHEMQGYITNPRVVSDIELDRAKAIEKAVEDAHAHADRLTILL
VIGKGEERWIKVDGKHAPYEGDDHVVKRLFGLLND
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggctttgactttggctgcggccgccgaattgctcgaccgacatcatctgctccgcgaa
atcatccaaggcgattgctggaccgacgatgcagcggatctcgccggcgccgacgagccg
ttcaccgccattacctatgacacgcgcaaggtcgttcccggcacgctcctgtgctgcaag
ggtcggttcaaggctgaatacctgaccgatatcgacaccaccggactcgccgcgtatgtg
gcggaaaccgaatactccgccgtcacccgcacccctggtctaatcgtcaatgacgcacgc
aaggccatgagcctgctgtccgctgagttctatggccgcccgcaggatgagctgaccgtc
atcggtatcaccggcaccaagggcaagacgaccaccgcctattttgtgcaggccgtgctc
aacgcctattccggcggcagggccgcactgttctcttcggtggacaattgcttggacggc
cacacatatgcagaatccgacctgaccacgcccgagtcgatggacgctttccgcatgatg
cgcgaagccgcgaataacggcatgcggtatctggtgatggaagtctcctcccaggcatac
aaagtggagcgcgtgtatggcctgacgttcgatgctggggcattcctcaatatttcccct
gaccacatcagcgccatcgaacaccccacattcgaggattatctgtattgcaagcggcag
atcacacacaattgccgcacactggtgctcggcgccgactgcgatcatgccgatttgatt
cggcaggatgctcaagcctcgaatgtaccggtcaccacttttgcgctgcatgctgcggac
gggcacggcacgcatgccgatttcgtcgcgctgccggatgcatcctcaggctacctgttc
caggagcagggcaaggctattggcgatttttcgctggaactggaaggcgagttcaatgcc
gccaacgccgctgccgccattgctttgtcacgtgcagtcggcgtaccagctggctcagag
gctttccgcgctctggaacgtgtgcatattcccgggcgtatggaacattatgaatccggc
aatatggtggcgtacgtagattatgcgcacaactatgtgagcacgaagaccctggccgag
ttcgtgacacataaatacgcggatcgcaatccgcgtgtcgtcgtggtcactggctccgtg
ggagataaagccgtggaccgccgtgaaggcatcatcaagggtgcgcaggattatgcggat
cgcattattctgactgcggaagacacagtgcacgagcgcatgatcgatattcttcatgag
atgcagggttatatcaccaatcctcgagtcgtctcggatatcgagctcgatcgtgcgaag
gccatcgaaaaagcagtcgaggatgcgcacgcccatgcggacaggctgaccattctgctg
gtcatcggcaagggcgaagaacgttggatcaaggtcgatggcaagcacgcgccttacgag
ggcgatgaccatgtggtcaagcgactgttcggactgttgaacgactga

DBGET integrated database retrieval system