KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_0708Help
Entry
HMPREF9228_0708   CDS       T01844                                 

Definition
putative ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bbv00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    HMPREF9228_0708
Enzymes [BR:bbv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     HMPREF9228_0708
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
841541..842533
Genome map
AA seq 330 aa AA seqDB search
MVISEEEHEQMPEPVRERLEALKDAQGSVIVIGSMNADYTVTTKRLPKPGETVQGGAMKV
MPGGKGANQASAAARLGLNVQLLGAVGDDANADFLLSKLDEAGVDTADVLHVEGPSGTTV
ITVSAEGENTIVYSPGANSKAAAGYVQSHRLTIAGCSVLGLCLESPISTVVAAAQTAHDA
GVTVLLNDSPFMDELPHELVEVTDILLVNQHEVAQLLGLPDGDVESLDWYEVAERFTDYG
FDRAIVTLGASGSVVIENGRWHRVSAAQVKAVDTTGCGDSFMGTVLAGFAAGYTLLQSAQ
IGSYVSAYAATKIGAQSAYGTADEVVAYFS
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atggtgataagtgaagaagaacatgaacagatgccggagcccgtacgggaacgactggaa
gcgctgaaggatgcgcagggctcggtaatcgtaattggttcgatgaatgccgattacaca
gtgacgactaaacgactgcccaagccgggcgagaccgtccagggcggtgccatgaaggtg
atgcccggcggcaagggtgctaatcaggcgtccgctgcagcccgtctcggcttgaatgtc
cagctgctgggtgcagtgggcgacgatgccaatgcggatttcctgctgagcaaactggac
gaggccggcgttgacaccgccgatgtcctgcatgtcgaaggccccagcggcaccacggtg
atcaccgtcagtgccgagggggagaacaccatcgtctattctccgggagccaattccaag
gcggctgcgggctatgtgcagtcgcatcgattgaccatcgccggttgctcggtgctggga
ctgtgcctggaaagcccgatttccaccgtggtcgccgccgctcagactgcgcatgacgcc
ggtgtgactgtgctgctcaacgactcgccgttcatggacgagctgccccatgaactggtg
gaggttaccgatatcctgctggtcaatcagcatgaagtggcccagctgttggggctgccg
gacggcgatgtggagtcgctcgactggtatgaagtcgccgaacgattcacggattacggc
tttgatcgcgccatcgtgacgcttggtgcatccggttccgtggtgattgaaaacggccgt
tggcatcgtgtgtctgcagcgcaagtcaaggcggtggacaccaccggttgcggcgactcg
ttcatgggtaccgtgcttgcggggtttgccgccggctatacgctgctgcagtccgcgcag
atcggctcctatgtttccgcctatgccgccacgaagatcggcgcccaaagcgcctacggc
accgccgacgaggtcgtcgcatacttcagctga

DBGET integrated database retrieval system