KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_0741Help
Entry
HMPREF9228_0741   CDS       T01844                                 

Definition
(GenBank) phosphoglycerate mutase family protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
Pathway
bbv00010  Glycolysis / Gluconeogenesis
bbv00260  Glycine, serine and threonine metabolism
bbv00680  Methane metabolism
bbv01100  Metabolic pathways
bbv01110  Biosynthesis of secondary metabolites
bbv01120  Microbial metabolism in diverse environments
bbv01130  Biosynthesis of antibiotics
bbv01200  Carbon metabolism
bbv01230  Biosynthesis of amino acids
Module
bbv_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bbv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF9228_0741
  Energy metabolism
   00680 Methane metabolism
    HMPREF9228_0741
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HMPREF9228_0741
Enzymes [BR:bbv01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     HMPREF9228_0741
Membrane trafficking [BR:bbv04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    HMPREF9228_0741
Exosome [BR:bbv04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   HMPREF9228_0741
  Exosomal proteins of melanoma cells
   HMPREF9228_0741
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AEF27269
Position
886700..887545
Genome map
AA seq 281 aa AA seqDB search
MIDEVMMLRHGRTQYNLEHRLQGQIDVPLDIVGQWQVDQTGFALASRYYWAKVNRLASHP
EAIAQPGPDAAERTDIHQYEEAPAAGRRMVILTSDLFRAQQTAHAFADVLGLPVVCDRRL
RERSFGEWEGLTRAEIKAVAAEDYASWKHHTGGETKHGVESRAEVGKRGADAVRALVCDS
AYADDTPTTLMLVTHGSWITATIANLLDLDPDGMNALGAMRNACWCRLKVRHSVNGQSTE
QPLWELEEYNKAPAIADCADWENGPADLRGPHMPGWQPIVW
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgattgatgaagtgatgatgctgcgccacggccgtacccaatacaatctcgaacatcgt
ttgcaaggccaaatcgatgtgccgctcgacatcgtaggccaatggcaggtcgaccaaacc
ggattcgcgctcgcctcacgctattactgggccaaggtaaaccgtctggcctctcatccc
gaagccatcgcgcagcccggaccggatgccgcggaacgtaccgatattcaccaatatgag
gaagctccggcagccggccggcgcatggtgatattgaccagcgatctgtttcgcgcgcaa
cagaccgctcacgcctttgcagatgtgctgggattgccggtggtctgcgatcgccgtctt
cgcgaacgcagctttggtgaatgggaaggcctgacccgcgctgagatcaaagccgtggcc
gctgaggactacgcctcctggaagcaccacactggcggggaaaccaaacacggggtggaa
agtcgcgccgaagtcggcaagcgcggagctgacgcagtgcgcgcattggtctgtgattcg
gcttatgcggatgacacgcccaccacgcttatgctggtcacccatggctcatggattacc
gccaccattgccaatctgcttgatctggatcctgacggtatgaacgcgcttggtgccatg
cgcaacgcctgttggtgccgactgaaagtgcgtcacagcgtcaatggccaatcgacggag
cagccactgtgggagctggaagaatacaacaaggcacccgccattgccgattgcgcagac
tgggagaacgggcccgccgacctgcgcggaccgcacatgccaggctggcagccgattgtg
tggtga

DBGET integrated database retrieval system