KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_0813Help
Entry
HMPREF9228_0813   CDS       T01844                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
Pathway
bbv00260  Glycine, serine and threonine metabolism
bbv00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bbv01100  Metabolic pathways
bbv01110  Biosynthesis of secondary metabolites
bbv01130  Biosynthesis of antibiotics
bbv01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bbv00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HMPREF9228_0813 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HMPREF9228_0813 (trpA)
Enzymes [BR:bbv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HMPREF9228_0813 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA BtpA
Motif
Other DBs
NCBI-ProteinID: AEF27808
Position
952209..953078
Genome map
AA seq 289 aa AA seqDB search
MTNEATTPSGQPLGISHKPSKSGAMFTKFKAENKPAFIGYLPYGFPNPDVSLDAFKTMVE
HGVDAVEIGLPYSDPVMDGPVIQAAASIALNNGETIKRVFEAVETVANAGGMPLIMSYWN
LVYHYGVERFARDFENVGGAGLITPDLIPDEAGEWIEASDRHGLDRIFLVSPDSSTERLE
TVARNARGFVYAAARMGVTGERATIDASPELLVERTRQAGAENVCVGIGVSTAEQGAKVG
SYSDGVIVGSALVHTLLADDNKTARDPKEGLKLLAAKSEELAEGIHNAR
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacgaagcaaccacgccgtccggccagccgctgggcatcagccacaagcccagc
aagtcgggcgctatgttcaccaagttcaaggccgagaacaagcccgccttcatcggctac
ctgccctatggcttccccaacccagacgtctcgcttgacgccttcaaaacgatggtcgag
cacggcgtcgacgccgtggaaatcggcctgccgtactccgacccggtcatggacggcccg
gtcatccaggctgccgcctccatcgccctgaacaacggcgagaccatcaagcgcgtgttc
gaggccgtcgaaaccgtggccaacgccggcggcatgccgctcatcatgagctactggaac
ctcgtgtaccactacggcgtcgagcgcttcgcccgcgacttcgagaacgtcggcggcgcc
ggtctcatcaccccggaccttatcccggacgaggcgggggagtggatcgaagcctccgac
cgccacggactcgaccgcatcttcctggtctccccggactcgtccaccgagcgcctcgaa
accgtggcccgcaacgcgcgcggcttcgtgtacgcggccgcccgcatgggcgtcaccggc
gaacgcgccaccatcgacgcctcgcccgaactcctcgtggaacgtacccgtcaggccggt
gccgagaacgtgtgcgtgggcatcggcgtgtccaccgccgaacagggcgccaaggtcggc
tcctactcggacggcgtcatcgtcggctccgcgctcgtgcacaccctgctcgcggacgac
aacaagaccgcacgcgacccgaaggaaggcttgaagctgctcgccgccaagagcgaggaa
ctggccgaaggcatccacaacgcacgctaa

DBGET integrated database retrieval system