KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_0831Help
Entry
HMPREF9228_0831   CDS       T01844                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bbv00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HMPREF9228_0831
   00052 Galactose metabolism
    HMPREF9228_0831
   00500 Starch and sucrose metabolism
    HMPREF9228_0831
   00520 Amino sugar and nucleotide sugar metabolism
    HMPREF9228_0831
Enzymes [BR:bbv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     HMPREF9228_0831
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(967329..968831)
Genome map
AA seq 500 aa AA seqDB search
MTELNNEAQLSVNDDATAENTAEAHIEEVFSHSAAKMREKGMSETAINQFHHLYSVWQHE
EASNWIREDDVEPLEQVPSFHDVYETINHDKAVDAFAKTAFLKLNGGLGTSMGLECAKSL
LPVRRHKARQMRFIDIIIGQVLTARTRLNVELPLTFMNSFRTSADTVKVLKRNRKFTQHE
IPMEIIQHQEPKLVAATGEPVSFPENPDLEWCPPGHGDLFSTIWESGLLDVLEEHGFKYL
FISNSDNLGARPSRTLAQHFENTGAPFMAEVATRTKADRKGGHIVRDKSTGRLMLREMSQ
VHPDDKAAAQDIKKHPYFNTNSIWIRIDALKAKLAEYNGVLPLPVIRNKKTVNPTNPDTE
QVIQLETAMGAAIGLFNGAICVQVDRMRFLPVKTTNDLFIMRSDRFHLTDNYEMEDGNYV
FPNVELDPRYYKNIHDFDERFPYAVPSLAAANSVTIQGDWTFGRDVTMFADAKLDDQGKP
SYVPNGAYVGPQGIEPDDWV
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
ttgaccgaactgaacaatgaagcccagctcagcgtaaacgatgatgccaccgccgagaac
accgcggaagcccacatcgaagaggttttctcacattccgccgccaagatgcgcgagaaa
ggcatgagcgaaaccgccatcaatcaattccatcatctctatagcgtatggcagcacgaa
gaggcatcaaactggatccgagaggacgatgtggagccgcttgagcaggttcccagcttc
cacgatgtttacgagaccatcaatcacgacaaggccgtggacgcgtttgcaaaaaccgcg
ttcctcaagcttaacggcggtctcggcacctccatgggtctggaatgcgccaagtccctg
ctgcctgtgcgccgccacaaggccaggcaaatgcgcttcatcgacatcatcatcggtcag
gtgctgaccgcccgtacccgtctgaacgtcgagctgccgctgaccttcatgaactccttc
cgcacttcggctgacaccgtgaaggtgctcaagcgcaaccgcaagttcacgcagcacgaa
atcccgatggaaatcatccagcatcaggagccaaagctggtcgccgccaccggcgagccc
gtcagcttcccggaaaacccggatttggaatggtgcccgccgggtcacggtgacctattc
tccaccatctgggaatccggtctgctcgatgtgctcgaagagcatggcttcaagtacctg
ttcatctccaattccgataatctcggtgctcgcccctcccgcacgctggcccagcatttc
gagaacaccggcgcaccgttcatggcggaggtcgccacccgcaccaaggccgaccgcaag
ggcggccacatcgtgcgggacaagtccaccggtcgactgatgctgcgcgagatgagccag
gtgcatcctgacgataaggcagcggctcaggacatcaagaagcacccgtacttcaatacg
aactccatctggattcgcattgacgcactcaaggccaagctcgctgaatacaatggagtg
ctgccgttgccggtgattcgcaacaagaagaccgttaatcccaccaacccggataccgag
caggtcattcagctcgaaaccgcgatgggcgcggccatcggcctgttcaatggtgccatc
tgcgtgcaggtggatcgtatgcgctttcttccggtgaagaccaccaacgatctgttcatc
atgcgttccgatcgcttccatctgacggacaactacgaaatggaagacggcaactacgtc
ttcccgaatgtggaacttgatccgcgctattacaagaacatccatgacttcgacgaacgc
ttcccatacgccgtgccatcattggccgcagccaactcggtaaccatccaaggcgactgg
acgttcggccgtgatgtgaccatgttcgctgatgccaaacttgacgatcagggcaagccg
agctacgtgccgaatggcgcatacgtaggcccgcaaggcattgaaccggacgattgggtc
tga

DBGET integrated database retrieval system