KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_0840Help
Entry
HMPREF9228_0840   CDS       T01844                                 

Gene name
sucC
Definition
succinate-CoA ligase, beta subunit (EC:6.2.1.-)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bbv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HMPREF9228_0840 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HMPREF9228_0840 (sucC)
   00640 Propanoate metabolism
    HMPREF9228_0840 (sucC)
   00660 C5-Branched dibasic acid metabolism
    HMPREF9228_0840 (sucC)
Enzymes [BR:bbv01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     HMPREF9228_0840 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(978308..979510)
Genome map
AA seq 400 aa AA seqDB search
MDLYEYQARQLLEEQDIPTPGAIFAQNSHEVAEAADKIGYPCVIKAQVKIGHRGQAGGVK
IAHNRDEAILESESILPMTIHGHKVSGVLVAEAKNILHEYYVSISVDRTSRDFDVLATAN
GGTEVEEIAKEHPEAVKRLHIDALDDFDLEAATKMAASIGFYHADVDQAAQILLKMWQCF
KDNDATLVEINPLAKIGDPDDESTKQLSALDAKISLDDNAAFRHDGWARFVDPIVPDPFE
QRAREHGLHYVHLHGEVGVIGNGAGLVMSSLDAVSGAGEEQGSGIKPANFLDIGGGASAT
VMAESLEIVLSDPQVESVFINVYGGITSCVEVANGILEAVAKLGGSKPIVVRFDGNAAAE
GLHILTEANNPNIHVSETMEGAAQKAAELAAESTQSKEIR
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggatctttacgaataccaggcacgtcagctgcttgaggagcaggacatccccaccccg
ggtgccatctttgctcagaactcccatgaagtcgccgaggctgcggataagatcggctac
ccgtgtgttatcaaggcgcaggtaaaaatcggtcaccgaggccaggccggcggcgtcaag
atcgcgcataaccgcgatgaggccatcctggaatccgaatccatcctgccgatgaccatc
cacggccataaagtatccggcgtgctggtggccgaagccaagaacatcctgcacgaatac
tatgtgtccatctccgtggaccgcacctcccgagacttcgacgtgctggcgaccgccaac
ggcggcaccgaagtcgaggaaatcgccaaagaacatcccgaggcggtcaagcgtctgcac
atcgacgcgctcgacgacttcgatctcgaggctgcgaccaagatggcagcgagcattggt
ttctaccatgctgatgtcgatcaggcggcgcagatcctgctcaagatgtggcagtgcttc
aaagacaacgatgcgacactggtggaaatcaatccgctcgcaaaaatcggtgacccggat
gacgaatccaccaagcagctgagcgcgctcgatgccaagatttccttggatgacaacgcg
gcattccgccacgacggttgggcccgtttcgttgatccgatcgttcccgacccgttcgag
cagcgcgcccgtgagcatgggctgcattacgtgcatctgcacggcgaagtcggcgtaatc
ggcaacggtgctggcctggtcatgagctccctggatgccgtatccggcgcgggcgaagag
caggggagcggcatcaagcctgccaacttcctggacatcggcggcggcgcatccgcgact
gtgatggccgaaagcttggaaatcgtgctgtccgacccgcaggtcgagtccgtgttcatc
aacgtgtacggcggcatcacctcctgcgtggaagtggccaacggcattctcgaagcggtc
gccaagctcggcggctccaagcccatcgtcgtccgattcgacggcaatgccgcagccgaa
ggcctgcacattctgaccgaagccaataatccgaatattcacgtgtccgagaccatggag
ggtgcggcgcagaaggccgctgaactcgccgctgagtcgacccagtccaaggagattcgc
tga

  All links  
No link information was found.   
DBGET integrated database retrieval system