KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_0987Help
Entry
HMPREF9228_0987   CDS       T01844                                 

Definition
isochorismatase family protein (EC:3.-.-.-)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    HMPREF9228_0987
Enzymes [BR:bbv01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     HMPREF9228_0987
    3.5.1.-  
     HMPREF9228_0987
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1131968..1132582
Genome map
AA seq 204 aa AA seqDB search
MSKALIVVDVQPTFCEGGELGVEGGNAVAERIADYVNAHRGEYAYIATTQDWHIEPGAHW
SAEPDFVDTWPKHGAAGTSNAELHPAIKALGVEHHFKKGQYSAAYSGFEGIEDNTDRIQT
REEVSAEQAAGKTLADALKTAGVSRVDVVGIAESHCVKDTALDARKLGFEVTVFEDLTVP
VSEELGVAARKQMTAAGIALVESR
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaggcgttgattgtggtggatgtgcagccgacattttgcgagggcggtgaactg
ggtgttgagggtggcaacgcagtcgccgagcgcatcgccgattatgtgaatgcgcatcgt
ggcgaatacgcgtatatcgccaccacgcaggattggcatatcgagccaggcgcgcactgg
tcggctgagccagatttcgtggatacatggccgaagcatggcgcggccggtacgtcgaac
gccgaactgcatccggcgatcaaggcgctgggcgtcgagcatcatttcaagaagggccag
tattcggcggcatattccgggtttgagggtatcgaggacaatactgaccgcatccagacc
cgtgaggaggtctcggctgaacaggccgccggcaagacactagccgacgcgctgaagacg
gccggcgtgagtcgcgtggatgtggtgggcatcgccgaatcgcattgcgtcaaggacacc
gcgctcgatgccaggaagctcggtttcgaggtcaccgtgttcgaggacctgaccgtaccg
gtcagcgaggagctcggtgtcgcggcccgcaaacagatgacggcggccggcatcgcgctg
gtcgagtcgcgctga

DBGET integrated database retrieval system