KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_0987Help
Entry
HMPREF9228_0987   CDS       T01844                                 

Definition
isochorismatase family protein (EC:3.-.-.-)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:bbv00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1131968..1132582
Genome map
AA seq 204 aa AA seqDB search
MSKALIVVDVQPTFCEGGELGVEGGNAVAERIADYVNAHRGEYAYIATTQDWHIEPGAHW
SAEPDFVDTWPKHGAAGTSNAELHPAIKALGVEHHFKKGQYSAAYSGFEGIEDNTDRIQT
REEVSAEQAAGKTLADALKTAGVSRVDVVGIAESHCVKDTALDARKLGFEVTVFEDLTVP
VSEELGVAARKQMTAAGIALVESR
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaggcgttgattgtggtggatgtgcagccgacattttgcgagggcggtgaactg
ggtgttgagggtggcaacgcagtcgccgagcgcatcgccgattatgtgaatgcgcatcgt
ggcgaatacgcgtatatcgccaccacgcaggattggcatatcgagccaggcgcgcactgg
tcggctgagccagatttcgtggatacatggccgaagcatggcgcggccggtacgtcgaac
gccgaactgcatccggcgatcaaggcgctgggcgtcgagcatcatttcaagaagggccag
tattcggcggcatattccgggtttgagggtatcgaggacaatactgaccgcatccagacc
cgtgaggaggtctcggctgaacaggccgccggcaagacactagccgacgcgctgaagacg
gccggcgtgagtcgcgtggatgtggtgggcatcgccgaatcgcattgcgtcaaggacacc
gcgctcgatgccaggaagctcggtttcgaggtcaccgtgttcgaggacctgaccgtaccg
gtcagcgaggagctcggtgtcgcggcccgcaaacagatgacggcggccggcatcgcgctg
gtcgagtcgcgctga

DBGET integrated database retrieval system