KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_1112Help
Entry
HMPREF9228_1112   CDS       T01844                                 

Gene name
glgB
Definition
1,4-alpha-glucan-branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:bbv00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    HMPREF9228_1112 (glgB)
Enzymes [BR:bbv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     HMPREF9228_1112 (glgB)
Exosome [BR:bbv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HMPREF9228_1112 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1271019..1273271
Genome map
AA seq 750 aa AA seqDB search
MANETKIKEDTVTVPVAQSDLDAVSNAEFYNPHGVLGGHLGIGKHADTATIRVLRPLAKS
VTILTQDGEYPMTHEYNGVFVTTVPAAGTKKQPTIPDYRVKTEWESGDVLIEDDPYRYMP
TLGEMDTYLFGEGRHEKLWEALGAHVLRYDDPMGGADGTPGKQVVGTAFSVWAPNAHAVR
VVGNFNAWDGRRHAMRELGSSGVWEIFIPGLGAGENYKFQILNANYVWEMKADPMERQHE
IPPNTASIITESSYEWADDAWMQHRRTTNPHNGPVSIYEVHAGSWKKGLSYRDLATELVD
YVKQEGYTHVEFMPLAQHPFSGSWGYQVTGYYAVDSRLGSPDDFRYLVDKFHQAGIGVIM
DWVPAHFPKDAFALGRFDGTPLYEDPDPLRGEHPDWGTYVFNFGRREVRNFLVANALFWL
EDLHVDALRVDAVSSMLYLDYSREPGQWRPNIYGGRENLEAIDFLKEATATAYKNNPGVM
MIAEESTAWPGITAPTSAGGIGFGLKWNMGWMHDTLEYLHEEPINRKWHHNEITFSMVYA
YSENYVLPISHDEVVYGKGSVYGKMPGNGWQKMAGVRELFAYQWAHPGKKLSFMGNELAQ
WGEWDHDASIDWDCLNWQDHRQVQTMVADLNAFYKANPALWSQDFDPAGFQWLTSDDADH
NTLSFLRIGTKGETLAVVVNFSGEAWSDYQVALPTGGKWTEVFTTDDAKYGGSDIHNGTF
EADAGEYHSRPFSAKITVPALAVVFLKPEN
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
atggctaatgaaacgaagatcaaggaagataccgtcaccgtgcctgttgcccaaagtgac
ctcgacgcggtgagcaatgctgaattctacaacccccacggagttcttggcgggcatctc
ggcattggcaagcatgccgataccgccacaatccgtgtgctgcgtccacttgccaaatcc
gtgaccattctcacccaagacggcgaatatccgatgacacacgaatacaacggcgtattc
gtgaccaccgttcccgccgcggggaccaaaaagcagcccaccattcccgattaccgcgtg
aaaaccgaatgggaaagcggcgacgtgctcatcgaggatgacccctaccgctacatgccc
acacttggcgaaatggacacctacctgttcggcgaaggtcgccacgaaaagctctgggaa
gccctcggcgcacacgtgctgcgctatgacgacccaatgggcggtgccgatggcacgccc
ggcaaacaagtggtgggcaccgccttctccgtatgggcgccaaacgcccacgccgtgcgt
gtggtcggcaacttcaacgcctgggacggccgccgccacgccatgcgcgagctcggttcc
tccggcgtgtgggaaatcttcattcccggtcttggcgcaggcgagaactacaagttccaa
atcctcaatgccaactacgtgtgggagatgaaggccgacccgatggagcgtcagcacgaa
atcccgccgaacaccgcatccatcatcaccgaatcctcctacgagtgggccgatgacgcc
tggatgcagcaccgccgcaccaccaacccgcacaacggcccggtctccatctacgaggtg
catgccggcagttggaagaagggcctgagctaccgcgacctagccacggaattggtggac
tacgtcaagcaggagggctacacccacgtcgagttcatgccgttggcccagcacccgttt
tccggatcctggggctatcaggtcaccggttactacgcggtggattcacgcctcggctcc
cccgacgatttccgttacctggtcgacaagttccatcaggccggcatcggcgtgatcatg
gactgggtgcccgctcacttcccgaaggatgcctttgcgctcggccgtttcgatggcacc
ccgctgtacgaggatccagacccgctgcgcggcgaacaccccgattggggcacctatgtg
ttcaacttcggacgccgcgaggtgcgcaacttcctggtggccaacgccctgttctggctt
gaggacctgcacgtcgacgcactgcgcgtggatgccgtcagctccatgctctacctcgac
tatagccgcgaacccggtcagtggcgcccgaacatctacggaggccgcgagaacctggag
gccatcgacttcctcaaggaggccaccgccaccgcttacaagaacaaccccggcgtgatg
atgatcgccgaggaatccaccgcatggccgggcatcaccgcccccacttccgccggcggc
atcggcttcggcctcaagtggaacatgggctggatgcatgacacccttgaatatctgcat
gaggagcccatcaaccgcaagtggcatcacaatgaaatcaccttctcgatggtgtatgcc
tactccgagaactatgtgctgcccatcagccacgacgaggtcgtgtacggcaagggatcc
gtatatggcaaaatgccgggcaacggttggcagaagatggccggcgtgcgtgaactgttc
gcctaccagtgggctcacccgggcaagaagctctcctttatgggcaacgagctggcacag
tggggcgagtgggatcacgatgcctccatcgactgggattgcctgaactggcaggatcat
cgccaggtgcagaccatggtggccgacctcaacgccttctacaaggcgaatccggcactg
tggagccaggacttcgatccggccggtttccagtggctcaccagcgacgatgccgatcac
aacacgctgagcttcctgcgcatcggaaccaaaggcgagacgctggccgtagtggtcaac
ttctccggcgaggcatggtccgactaccaggtggcactgcccaccggcggcaaatggacc
gaagtgttcaccaccgatgatgccaagtatggcggttccgacatccataatggcacgttc
gaggcggacgccggagaataccattcaaggcctttctcggctaaaatcaccgttccagct
ctcgcagttgtattcttgaagccagagaactga

DBGET integrated database retrieval system