KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_1141Help
Entry
HMPREF9228_1141   CDS       T01844                                 

Definition
glycosyl hydrolase family 3, N-terminal domain protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bbv00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:bbv00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1305344..1306561
Genome map
AA seq 405 aa AA seqDB search
MLVGSVLCVLALVVTALYGWRIGWFASMTGNDAAASSATADAARNTPQQLARSAAPKPDP
SPASKAHRMVNAMDMDTRIGQLVMAPLYAGNAPASLSSLIADRHVGSVLIIGKWTGGVAS
VRAAADQLQGYAPGDNRLIISTDQEGGWVQHLTGPGFDRMPTAVDQGTMSTNQLRQSASV
WGSQMAAAGINVDLAPVLGTVVVNRAANAPIGALYRDFGLDAEGNAAHGTAFVQGMADAG
VQSAIKHYPGLGAVTDNTNFTADGILDTTTTLDGTEIKAFDTTIDQANPAMVMMALATYQ
AIDPNNPAVFSSIIIDGHLRGDLGYDGVVISDSMSAAAVSAYDTTQLGVKLVEAGGDLVC
IGDTNYVVPILDGLSTRTASDPAFANKVTQSAIRVMTLKIKMGLA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
gtgttggtcggatccgtattgtgcgtactagcgctggtagtcacggcgctgtatggatgg
cgcatcggctggtttgcatcgatgactggaaatgatgccgcggcaagttccgctacagca
gacgctgcacggaacactccgcagcagttggcacgttcggcggcccccaagccggatccc
tcccctgccagcaaagctcatcgcatggtcaatgccatggatatggacactcgaattggt
cagttggtgatggcaccgctgtatgccggcaacgccccggcctcgctgtcttcactcatc
gccgaccgccatgtgggatcggtgctgatcatcggcaaatggaccggaggggttgcctca
gtgcgggctgcggccgaccagttgcaggggtatgctcccggtgataaccgcctgattatc
tccaccgatcaagagggaggctgggtacagcatctgaccggccctggttttgatcggatg
cccacggcagtggatcagggaaccatgtcgaccaatcagttgcgtcaatcggccagcgta
tggggctcacagatggcagccgccggcattaatgtcgatcttgcacccgtgctgggcacg
gtagtggtaaatcgggccgccaacgcccccattggtgcgctctatcgcgatttcggactg
gacgcggaaggcaacgcggctcatggcacggcgtttgtgcagggcatggccgatgccgga
gtccagtccgccatcaaacattatccgggattgggcgcggtgaccgacaacacgaatttc
accgccgacggcatcctggatacgaccaccaccttggatggcacggaaatcaaagcgttt
gacaccaccatcgaccaggccaaccctgccatggtgatgatggcattggccacctatcag
gccattgaccccaataatcccgcggtgttttcctcaatcatcattgacgggcatcttcgc
ggcgatctgggatatgacggcgtagtgatttcggattcgatgtcggcagcggctgtgagc
gcctatgacaccactcaattgggagtcaaactcgtggaagccggcggcgatttggtctgc
atcggagacaccaactatgtcgtgccgattctggatggattgtctacgcggacggcatcg
gatcccgccttcgccaataaggtcactcagtcggcgattcgtgtgatgacgttgaaaatc
aagatggggttggcttaa

DBGET integrated database retrieval system