KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_1145Help
Entry
HMPREF9228_1145   CDS       T01844                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bbv01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:bbv00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:bbv00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1309550..1311040
Genome map
AA seq 496 aa AA seqDB search
MATTFHSTRSTTDSLTAKQAIRKGIADDGGLFVSDALGETKVDVASLPGKTYQQIAAEVL
GTLLPDFTAEELGQCIADAYGEQWSDERITPLKPLGDDYVLELFNGPTSAFKDVALQILP
RFMAHTTPADGDADEKIMILTATSGDTGKAALAGFADAPGTAITVFYPEGKVSQVQELQM
TTQAGSNVQVAAVEGNFDDAQSAVKRIFGDRALAERLAGNAHVVLSSANSINVGRLVPQV
VYYFSAYAQLLADQVINVGDEVEFVVPTGNFGDILAGYYAKLLGLPVKHLVVASDKNNVL
FDFLTTGTYNRQRPFFQTISPSMDILISSNLERMLYYLSEGDTRLISMLMNDLNQWGTYE
IPEELLAKIRQIFGTGWADEDQVCESIKHCWDENHYVIDPHTACGYYLLEQMPRDPLTPR
VLLSTASPYKFPRVVNEALGFDATGTDFECMDVLARETGTTAPVALRGLETADVRFKDVV
AIDGMEDYVEKAAQSL
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
gtggctaccaccttccattccactcgcagcaccaccgattcgctgaccgccaagcaggcg
attcgtaagggcattgccgacgacggcggcctgttcgtctcggacgcattgggcgagacc
aaggtggatgtcgcctcgctgccgggcaagacctaccagcagatcgccgccgaagtgctg
ggcacgctgctgcccgacttcaccgccgaggaactgggccagtgcatcgccgatgcctac
ggcgagcagtggtccgacgagcgtatcactccattgaagcctctgggtgacgattacgtg
ctcgaactgttcaacggtccaacctccgcattcaaggatgtggccctgcaaattctgccg
cgtttcatggcgcacaccacgccagccgacggcgacgcggacgagaagatcatgattctc
accgccacctccggcgacaccggcaaggccgcgctggccggcttcgcggacgccccgggc
accgccatcaccgtcttctacccggaaggcaaggtctctcaggtccaggagctgcagatg
accacgcaggccggctcgaacgtgcaggtggccgctgtggaaggcaacttcgacgacgcc
cagtccgcggtcaagcgtatctttggcgaccgagccctagccgagcgtctcgccggcaat
gctcacgtggtgctttcctccgccaactccatcaatgtgggccgtctggtgccgcaggtc
gtctactacttctccgcctacgcccagctgctagccgatcaggtgatcaacgttggcgat
gaggtcgagttcgtggtcccgaccggcaacttcggcgatatcctcgccggctactacgcc
aagctgctcggcctgccggtcaagcacctcgtggtggcttccgacaagaacaacgtgctg
ttcgacttcctgaccaccggtacctacaaccgtcagcgcccgttcttccagaccatctcc
ccctcgatggacatcctcatctcctccaacctggagcgcatgctgtactacttgtccgag
ggcgacacacgcttgatctccatgctgatgaacgacctcaaccagtggggcacgtacgag
attccagaagagctgctggccaagattcgccagatcttcggcaccggttgggccgacgag
gaccaggtgtgcgaatccatcaagcactgctgggatgagaaccactacgtaatcgacccg
cacaccgcatgcggctactacctgcttgagcagatgccgcgcgacccgctgaccccgcgc
gtgctgctctccaccgccagcccctacaagttcccgcgcgtggtgaacgaggctctgggc
ttcgacgctaccggcaccgacttcgagtgcatggacgtgctggcccgtgagaccggtacc
actgccccggtcgccctgcgtggcctcgagaccgccgacgtgcgtttcaaggacgtcgtg
gccatcgacggcatggaggactacgtagaaaaggccgcccagtcactgtaa

DBGET integrated database retrieval system