KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_1367Help
Entry
HMPREF9228_1367   CDS       T01844                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bbv00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1551718..1553793)
Genome map
AA seq 691 aa AA seqDB search
MEHREFKWPQPLAGGKPRIWYGGDYNPDQWPEEVWDEDVALMQKAGVNLVSVAIFSWAKL
EPEEGVYDFDWLDRVIDKLGKAGIAVDLASGTASPPMWMTQAHPEILWVDYRGDVCQPGA
RQHWRATSPVFLDYALNLCRKMAEHYKDNPYVVSWHVSNEYGCHNRFDYSEDAERAFQKW
CEKKYGTIDAVNDAWGTAFWAQRMNNFSEIIPPRFIGDGNFMNPGKLLDWKRFSSDALLD
FYKAERDALLEIAPKPQTTNFMVSAGGAGIDYDKWGYDVDFVSNDHYFTPGEAHFDELAY
SASLCDGIARKNPWFLMEHSSSAVNWRPINYRVEPGELVRDSLAHLAMGADAICYFQWRQ
SKAGAEKWHSSMVPHAGPDSQIFRDVCELGADLNKLADEGLLSTKLVKSKVAVVFDYESQ
WATEHTATPTQEVRHWTEPLAWFRALADNGLTADVVPVRGPWDEYEAVVLPSLTILSEET
TRRVREYVANGGKLFVTYYTGLVDDKDHVWLGGYPGSIRDVVGVRVEEFAPMGNDFPGAM
DHLDLDNGTVAHDFADVITSVADTAHVVASFKADKWTGFDGAPAITINDFGDGKAAYVGA
RLGREGLAKSLPALLEELGIETSAEDDRGEVLRVERADETGENHFVFLFNRTHDVAIVDV
DGEPLVASLAQVNESEHTAAIQPNGVLVVKL
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atggaacatcgcgaattcaagtggccgcagcctcttgcgggtggcaagccccgcatctgg
tacggcggcgattacaaccccgaccaatggcctgaggaagtgtgggacgaagatgtagcc
ctcatgcagaaggccggcgtcaacctcgtctccgtagccatcttctcttgggccaagctt
gagcccgaagaaggcgtgtatgacttcgattggctcgaccgcgtcatcgacaagctcggc
aaggccggcatcgccgtcgatctcgcctccggcaccgcatccccgccgatgtggatgacc
caggcccacccggagatcctctgggtcgactaccgcggcgacgtctgccagcccggtgcc
cgacagcactggcgggccaccagcccggtcttccttgactacgcgctcaacctgtgtcgc
aagatggccgagcactacaaggacaacccctatgtggtctcttggcacgtgagcaacgag
tacggctgccacaaccgcttcgactactccgaagatgctgagcgcgccttccagaagtgg
tgcgagaagaagtacggcaccatcgacgccgtcaatgacgcctggggcaccgccttctgg
gcgcagcgcatgaacaacttctccgagatcatcccgccgcgcttcatcggcgatggcaac
ttcatgaacccgggcaaactgcttgactggaagcgcttcagctccgacgccctgctcgac
ttttacaaggccgagcgcgacgccctgctcgagatcgcccccaagccgcagaccaccaac
ttcatggtctccgccggcggtgccggtatcgattacgacaagtggggttacgacgtggac
ttcgtgtccaacgatcactacttcactcctggcgaagctcacttcgatgagctggcctac
tcggcctccctgtgtgacggcatcgcccgcaagaatccgtggttcctcatggagcactcc
agctccgccgtcaactggcgtccgatcaactaccgcgtcgaacccggcgaactggtgcgc
gactccctggcccacctggccatgggcgccgacgccatctgctacttccagtggcgccag
tccaaggccggtgccgagaagtggcactcctcgatggttcctcacgcgggccccgactcc
cagatcttccgcgacgtgtgcgagctgggtgccgacctcaacaagcttgctgacgagggc
ctgctgagcaccaagctggtcaagtccaaggtcgccgtcgtcttcgattacgagtctcag
tgggctacggaacacaccgccacgcctactcaggaggtacgccattggaccgagccgctc
gcgtggttccgcgcgctggcggacaacggtctgaccgcagacgtggtgccggttcgcggt
ccctgggacgagtacgaagccgtcgtgctgccgagcctgaccatcctgtctgaagagacc
acgcgccgcgtgcgcgagtatgtggcgaacggcggcaagctgttcgtgacctactacacc
ggtctggtggacgacaaggatcacgtctggctgggtggctaccccggctccatccgtgac
gtggtgggcgtgcgcgttgaggaattcgccccgatgggcaacgacttccccggtgccatg
gaccacctcgacttggacaacggtaccgtggcgcacgatttcgccgacgtgatcacctcc
gtggctgataccgctcacgtggttgcttccttcaaggctgataagtggaccggtttcgac
ggcgctcccgccatcaccatcaacgacttcggcgacggcaaggccgcatacgtcggtgcc
cgtctcggccgtgagggcttggccaagagcctgcccgcgctgctggaggaactcggcatc
gagacctcggccgaagacgatcgcggcgaagtgctgcgcgttgagcgtgcggatgaaact
ggcgagaaccacttcgtgttcctgttcaaccgcacccacgatgtggcgattgtggacgtg
gacggcgagccgctggtcgcctcgctggctcaggtcaacgaatccgagcatacggcggcc
attcagccgaacggtgtgctggtggtaaagctgtaa

DBGET integrated database retrieval system