KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_1493Help
Entry
HMPREF9228_1493   CDS       T01844                                 

Gene name
xseA
Definition
exodeoxyribonuclease VII large subunit (EC:3.1.11.6)
Orthology
K03601  
exodeoxyribonuclease VII large subunit [EC:3.1.11.6]
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
Pathway
Mismatch repair
Class
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:bbv03430]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1724925..1726280
Genome map
AA seq 451 aa AA seqDB search
MGYSNTGQSPTAASLASAGFGPNTATEAGQGTVNLPDGPRPVDQLPRLAAETTAQNPWPV
SMLSQKFYGAVERWPSAWVTGQITQINTRRAGSAYITLRDDFEDIAMEVNGFGRFADTAR
QFVQGDRVVIHGKPNLWMKRTSLSLRGDTILKVGAGGSLKDMIDELRKRLKGEGLFDADH
KLPLPEFPKTIGLICAPQARAEGDVITNVNLRWPSVTFKVVHVHVQGEQCPGEVAQAIAR
LDTDPDVDVIIVARGGGSFEDLMGFSDERVVRAAYACTTPLISSIGHEDDWTLLDLVADL
RASTPTDAAKRVVPDVNEQTQLITGAIDRMRLRIRSRVDNEDRLIEGYANRPSLTQPLTM
LEPHQRLIDDSIQRLDIGLRRIVDDAQLTVEKAHASLTALSPQSTLNRGYAVVQSADGTV
LDDASTAHIGDDITVTLKKGVITATTTSAAA
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgggttactcgaacacgggccagtcgccgaccgccgcatctttggcctcggccggtttt
ggccccaacacggccaccgaagccgggcagggaaccgtcaacctgcccgacggcccgcgg
ccggtcgaccagctcccaaggcttgccgcagagaccaccgcgcagaatccctggccggtc
agcatgctgagccagaaattctatggggcggtggagcgctggccgtccgcgtgggtcacg
ggccagattacccagatcaacaccagacgggccggttcggcgtatatcaccctgcgcgac
gatttcgaagacatcgcaatggaggtcaatggctttggacggtttgccgacacggcccgg
caattcgttcaaggcgatcgcgtggtcattcacggcaagcccaacctgtggatgaagcgc
acctccctctctttgcgcggagacaccattcttaaagtcggcgcaggtggcagcctcaag
gacatgatcgacgaattgcgcaagcgactcaaaggagaaggcctatttgacgcagaccat
aaactccctctgcccgaatttcccaagaccattggcctaatttgcgccccacaggcacga
gccgagggagatgtcatcactaacgtgaatcttcgctggccctcggtcaccttcaaggtt
gttcatgtgcatgtgcaaggtgagcaatgccccggcgaagtcgcacaagcgattgcacga
ctagacaccgatccagatgtggatgtcattatcgtggctcgaggaggcggctcattcgag
gacctcatgggcttctcggatgaacgcgtagtgcgtgccgcatatgcctgtaccacacca
ttgatttcctccatcggacatgaagacgattggaccctcctggacctggttgccgacctg
cgtgcttcaacccctacggacgcggccaaacgtgtggtgccggacgtcaacgaacagacg
cagctcattaccggagccatcgaccgtatgcgtctgagaattcgctcacgagtggataac
gaagatcgcctcatcgagggatacgcaaaccgccccagcctgacgcaacctctcaccatg
ctggagccgcatcagcgcttgattgacgattccatacagcgccttgatatcggcctgcga
agaatcgtggacgacgctcagctcaccgtcgagaaggcgcatgcctcactgaccgccctc
agcccccagtccacactcaaccgtggctatgccgtggtgcaatccgccgatggcaccgta
ctcgatgacgcttccaccgctcatatcggagacgacatcaccgtaaccttgaagaagggt
gtcatcacagccacaaccacatccgccgcagcgtaa

DBGET integrated database retrieval system