KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_1624Help
Entry
HMPREF9228_1624   CDS       T01844                                 

Definition
(GenBank) phosphoglycerate mutase 1 family
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bbv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HMPREF9228_1624
   01230 Biosynthesis of amino acids
    HMPREF9228_1624
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF9228_1624
  Energy metabolism
   00680 Methane metabolism
    HMPREF9228_1624
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HMPREF9228_1624
Enzymes [BR:bbv01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     HMPREF9228_1624
Exosome [BR:bbv04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   HMPREF9228_1624
  Exosomal proteins of melanoma cells
   HMPREF9228_1624
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1860622..1861362)
Genome map
AA seq 246 aa AA seqDB search
MTYKLVLLRHGQSAWNKTNQFTGWVDVPLTEQGEAEAKRGGELLKEKNVLPDIVFTSLLR
RAINTANIALDAADRLWIPVQRDWRLNERHYGALQGKNKTEIREEYGDEKFMLWRRSYAT
PPPEIDPNDQYAQNNDPRYAGDPVPEAECLANVVERVKPYFESAIEPELRAGKTVLIAAH
GNSLRAIVKMLDNLSEDEIAKVNIPTAIPLLYELDENFKPIKPRGEYLDPEAAAAGAAAV
AAQGQK
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgacttataaattagtactgctccgtcatggacagagcgcatggaataaaaccaaccag
ttcaccggctgggtcgacgtaccgctgaccgagcagggtgaagccgaagccaagcgtggc
ggcgagctgctcaaggagaagaacgtccttccggacatcgtgttcacctccctgctgcgt
cgcgccatcaacaccgccaacatcgctctggatgccgcagatcgcctgtggattccggtt
cagcgtgattggcgtctcaacgagcgtcactacggcgctctgcagggcaagaacaagacc
gagattcgcgaagagtacggtgacgagaagttcatgctgtggcgccgttcctacgccact
ccgccgcccgagatcgacccgaacgaccagtacgcccagaataacgacccgcgctacgcc
ggcgatccggttccggaagccgagtgcctggccaacgttgttgagcgtgtgaagccgtac
ttcgagtccgccatcgagccggagctgcgcgctggtaagaccgtgctgattgctgctcac
ggcaacagcctgcgtgccatcgtcaagatgctggacaacctgtccgaggatgagatcgcc
aaggtcaacatcccgaccgctatcccgctgctctacgagctggacgagaacttcaagccg
atcaagccgcgtggtgagtatctggacccggaggctgccgccgccggtgccgccgctgtc
gctgctcagggccagaagtga

DBGET integrated database retrieval system