KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_1710Help
Entry
HMPREF9228_1710   CDS       T01844                                 

Gene name
malQ_2
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbv00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    HMPREF9228_1710 (malQ_2)
Enzymes [BR:bbv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     HMPREF9228_1710 (malQ_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1948042..1950273)
Genome map
AA seq 743 aa AA seqDB search
MSENTESKERLARPLIRLAKLVGIGTSYVGMSHDYHEIDDDVLIEILSALGIEARNDDRQ
KEAIHRILKERHSRLVAPTVLHTVGEEDRLLVNTGIMEIPSASIILENGESYEGTIGVGP
GDGSPAFDLDGNFVSTASLIIPADVPVGYHTLHVKVGNRSQDATLISAPSQVPLIDPMKD
GSLWGWMAQLYSIRSSGSWGVGDYEDLKTILVDAKRKTGADFVLVNPLHAAEPVSPLTPS
PYLPVSRRLVNFTYIRPESVPEYATLPTDAKNEVDGLHSDVEPLNGDAQVIDRDAMWRSK
MHALWIIFKAGRTAERQAAFDQFKTDFGSDLEAYATWCLCYDKWGAPSAQGDNWEQALGR
DSQQIADLKRQFPDTLDFYRWLEWVASDQLAAAQQAAKDAGMEIGIMSDMAVGVHPLGAD
VWWNPERFAKGATVGAPPDMFNQQGQNWSQPPLSPLDLEATGYQTYRNMVHGMFARAGAV
RIDHILGLFRLWWIPENHSATDGAYVHYDSNIMLGILAIEASRANGVVVGEDLGVMPDYV
ADSLSGHGILGCAVEWFEQRDGVFRTPSQWRPYALASVNTHDLPPAAGYLEYEHVKIRER
LGLLTGPAEEFQASAKAEQNAMIAMLVDQGYLDADFAEHREEHEADIIDALYRALKGSPC
KLLAASITDAVGEKRAQNQPGTNNEYPNWRIPLADDKGNVVPLETLFDTPGAQRFAQIFN
NRLTPAPPLMRGLLAKRGGGETT
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagaataccgagagtaaagaacgattggctcgtccgctgattcgattggccaaa
ttggtgggtatcggtaccagctatgtgggcatgagccacgattatcatgagatcgacgat
gatgtgctcatcgaaatcctgtctgctctaggcatcgaagcccgaaacgacgatcggcaa
aaggaagccattcacaggattttgaaggaacgccatagccgactggttgctccaacagtg
ttgcataccgtcggcgaggaagaccgtctgctcgtcaacaccggcatcatggagatacct
tctgcaagcatcatcctggagaatggtgagtcatacgaggggaccatcggagtcgggccg
ggagacggatctccggcgttcgatttggatggtaactttgtgtctacggcatcgctgatc
attcccgccgatgtaccggtcggctatcacaccctgcatgtcaaggtcggtaaccgttcg
caggacgccaccctgattagcgcgccgagccaggttccgttgattgacccgatgaaggac
ggtagcctgtggggctggatggcgcagctgtactcgattcgttcctccggatcatggggt
gtcggcgattacgaggatttgaagaccatattggtcgacgccaagcggaagaccggcgct
gattttgtgctggtcaatccgttgcacgccgccgaaccggtgtctccgcttacgccgtcg
ccgtatcttccggtgagccgtcgtctggtcaatttcacgtatattcgccctgagtcggta
ccggaatacgccacattgccgaccgatgccaagaatgaagtggatggactgcactccgat
gtggagccgctgaacggcgatgcccaggtcattgaccgtgacgccatgtggcgcagcaag
atgcatgctctgtggattatcttcaaggccggtcgcactgccgagcgtcaggccgcattc
gaccagttcaagacggatttcggttccgacctcgaagcctatgccacgtggtgcctgtgt
tatgacaagtggggtgcgccctcggcacaaggcgacaattgggaacaggccctcggccgg
gattctcagcagattgctgatttgaagcgtcaattccccgatacgctcgacttctaccgc
tggctcgaatgggtggcgtccgatcagcttgccgctgcgcagcaggcggccaaggatgcc
ggcatggaaatcggcatcatgtctgatatggcggtcggtgtgcatcccctcggcgcggat
gtgtggtggaatcctgagcggttcgccaagggcgctacggttggcgctccgccggatatg
ttcaaccagcagggccagaattggagccaaccgccgctgagcccgcttgatttggaagcc
actggctaccagacctaccgcaacatggtgcatggtatgttcgcccgtgccggtgccgtg
cgcatcgaccatatccttggtctgttccgtctgtggtggattcctgagaatcattcggca
acggatggtgcctatgtgcattacgattccaacatcatgctcggcattctggccatcgag
gcgtcccgcgccaacggcgtggtggtcggtgaggatttgggcgtgatgcccgattatgtg
gccgattccctgtccggccacggcattctcggctgtgcggtcgaatggtttgagcagagg
gacggggtgttccgcacaccatctcaatggcgtccgtatgccttggcgtccgtgaatacc
catgacctgccgccggccgccggatacctggagtatgagcacgtcaagattcgcgaacgc
ttggggctgctgactggccctgctgaggagttccaagcttctgccaaggctgagcaaaac
gccatgattgctatgctggttgatcaaggatatctggatgccgatttcgccgaacaccgt
gaggagcacgaggcggacatcatcgatgcgttgtaccgtgcgctgaagggatctccgtgc
aagctgcttgccgcctcgattaccgatgcggtgggggagaagcgtgcgcagaaccagccc
ggcaccaataacgagtatccgaactggcgtatcccgctggccgacgataagggcaatgtg
gtgccgctcgaaaccctcttcgatacccccggtgcccaacgtttcgcccaaatcttcaat
aaccgactcactccagccccccctctgatgagagggctcctcgcgaagcgaggtggggga
gagacgacataa

DBGET integrated database retrieval system