KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_1757Help
Entry
HMPREF9228_1757   CDS       T01844                                 

Definition
glycosyl hydrolase, family 2 (EC:3.2.1.23)
Orthology
K12111  
evolved beta-galactosidase subunit alpha [EC:3.2.1.23]
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbv00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    HMPREF9228_1757
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    HMPREF9228_1757
Enzymes [BR:bbv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     HMPREF9228_1757
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1994586..1997750)
Genome map
AA seq 1054 aa AA seqDB search
MMSKQNDWENPSLTGRNRLAPHAYFFGYECEADASTYERERSYGYQSLSGAWRFRLFNGP
ATVPQKALLSIADDWDEVQVPHMWQFDGYGGLHYTDEPFPFPVDPPLVPSTTPTGVYQRM
VNMQPAADGERIILRFDGVDSYAEIHVNGTYVGMTKGSRLSAEFDVTDAVHAGLNLFVVT
VLQYSDGTYLEDQDMWWASGIFRDVYVVRRPQTHLKDFMVRTHRVDDTLAQVTVQTWTEG
ESCVEWTILRDGNIVSAAHSDSGERAVMNIPDPEYWNPEHPFLYDMRMRIVGRDGSGEIV
PHHLGLAEVTVEDGLMYLNGSYFTMHGVNRHDSDPRHGRAVSMERVRRDLEMMKRHNINA
VRTSHYPNDPRFYEMCDELGLMVMAETDLECHGFENVGDIALITDDPAWEVPYVDRIERH
VMQQRNHVSIVMWSLGNESGFGCNFRAAAERCRQLDPSRPVHYEEDRFGESVDVLSTMYS
RVSQMNDFGEHPADKPRVVCEYGHSMGNGPGGLSEYQQVFDRWPSIQGHFVWEWSDHAVA
MRGNRLALLAEREVQAKGVDPNGLDDLWYAYGGDFGDYPTGGNFCVDGLVFPWQEPSPGL
AEYRQVICPVKVSYTYTEEDGTALLGIDSHRYFTDLSDIRLRVSISADGETVDTTLLEVG
PVPPLGHMDIPLRREALLEHHGGEAMLTVTVLSVEQHEWCDPDEPLGSYQFRLHAGQGGY
GPVRSNDGASLAVTSPVRQTLSTVEDERYLTVRAGAMVLRFDKALGAIANWSDGGRNVID
SPICFGLWKPLIDNLTQEYSALWKPYYLDVMQTDTRGVQWHAERDQVIIEVEQRLAAPVV
LAGMRTRLTYTVHVDGHVDVAVTATAYGDYHDIIPRRGLSFTIPRDCRQVAWYGHGPGEN
YPDSLAANPVGVWTNDVDAMFTPYVMPQDCANHEGTRWVTFRDGNGNGVMVTRTAPVDGE
SEAFSFSAWPYSCADIDKAKHVNELPEGHGPVTVNINDGVLGLGSNSWGSEVLDSYRIRF
EDCAFSFTLTPIHDDEHVSRNPNCGAGAAGKEVQ
NT seq 3165 nt NT seq  +upstreamnt  +downstreamnt
atgatgagcaagcagaacgattgggagaatccctccctgaccggtcgtaaccgtcttgcc
ccgcacgcctatttcttcggatatgagtgtgaggcggatgcctccacctatgagcgcgaa
cgctcatacggttatcagagcctgagcggtgcatggcggttccgcctattcaatggcccg
gccaccgtgccacagaaggcgttgctgtcaatcgccgatgattgggatgaggtgcaggtg
ccgcatatgtggcagtttgacgggtatggaggtctgcactataccgacgagccgttcccg
ttccccgtcgacccgccgctggtgccgtccaccacgcctacgggcgtgtaccagcggatg
gtgaatatgcagccggctgcagatggtgagcgcattattctgcgtttcgatggtgtggac
agttatgctgagattcatgtcaatggcacatacgtcggcatgacgaagggctctcgcttg
tcggcggaattcgacgtgaccgatgcggtgcatgcggggttgaacctgttcgtggtcaca
gtgctgcagtattcggatggtacctatcttgaggatcaggatatgtggtgggcgtccggc
atcttccgtgacgtgtatgtggtcagacggcctcagacgcatctcaaggacttcatggtt
cgtacccatcgtgtggatgatacgctcgcacaggtcaccgtgcagacttggaccgaaggg
gagtcctgcgtcgaatggaccattctgcgtgacgggaatatcgtgtccgccgcgcattcg
gattcgggcgaacgtgccgtaatgaatattcctgaccccgaatattggaatcccgaacat
ccgttcctgtatgacatgcgtatgcgcatcgtcgggcgggacggttctggcgaaatcgtg
ccgcatcacctcggactggccgaagtcaccgtcgaggatgggctgatgtacctgaacgga
tcgtacttcaccatgcacggggtcaaccggcacgatagcgacccgaggcatgggcgtgcg
gtcagtatggagcgcgtgcgccgtgatctggaaatgatgaaacggcacaacatcaacgcc
gtgcgtacgtcacactatcctaacgatccgcggttctatgagatgtgcgacgaactgggc
cttatggtcatggccgaaaccgatttggaatgtcatggattcgaaaacgtgggcgacatc
gcactcatcaccgatgacccggcatgggaagttccctatgtcgatcgcatcgagcggcat
gtgatgcagcagcgcaaccatgtctccatagtaatgtggtctttgggcaatgagtctgga
ttcggatgcaatttccgtgccgctgccgaacggtgccggcaactcgacccatctcgtcct
gttcattatgaggaagatcgtttcggcgaatcggtggacgtgctgtcgaccatgtattcg
cgtgtctcccagatgaacgatttcggagagcatccggctgataagcctcgtgtggtctgc
gaatacgggcactcgatgggcaacggtcccggtgggctgagcgaataccagcaggtgttc
gaccgttggccgagtatccagggccattttgtctgggaatggtccgatcatgcggtggca
atgagagggaatcgtttggcgctattggccgagcgtgaggtgcaggccaaaggcgtggac
cctaatgggctggacgatctgtggtatgcctacggcggggatttcggcgattaccccacc
ggcggaaacttctgcgtggacggtctggtgttcccctggcaggagcccagtccggggctt
gctgaatatcggcaggtgatttgcccggtgaaggtcagctacacctataccgaggaggat
ggcaccgctctacttggcattgatagtcatcggtatttcactgatttgtccgacattcgg
ctgcgggtgtctataagtgcggatggtgaaaccgtggacacgacactgctggaggtgggg
cccgtgcccccgctcggtcacatggacataccgttgcgccgtgaagcgctgctggaacac
catggcggtgaagcgatgctcacggttaccgtgctgtccgtggaacagcatgagtggtgt
gatccggatgagccgctgggctcctaccagttccggctgcatgccggtcagggtggctat
ggcccggtgcgttcgaatgatggggcgtcgctcgccgtgacttctcccgttcgccaaaca
ttgtccaccgtcgaagacgaacgatatctgaccgttcgcgccggtgccatggtgcttagg
tttgacaaggcgctcggtgccatagccaactggagcgatggcggtcggaacgtcatcgat
tcgccgatatgtttcggcctgtggaaaccattgatcgacaaccttacgcaggaatactcc
gcgctctggaagccgtattatctggacgtcatgcagacggacactcgtggcgttcaatgg
catgcggaacgcgaccaggtgattatcgaggtcgagcagcgtctcgccgctcctgtggta
ttggccggcatgcgaacgagactgacctacacagtgcatgtcgacggccatgttgacgtc
gcggtgaccgccaccgcctatggcgactaccatgacatcattccacgccgaggcctgtcc
ttcactattccgcgggattgcaggcaggtcgcttggtacggtcacggcccgggcgagaac
tacccggattccctcgccgccaatccagtgggcgtgtggacgaatgacgtggatgccatg
tttacgccctatgtgatgccgcaggattgcgcgaatcacgaaggcacccgctgggtaacg
ttccgcgatggaaacgggaacggtgtgatggtgacgcggacggcgccggtcgatggtgag
tccgaggcgttctccttctccgcgtggccgtatagctgcgccgatatcgacaaagccaag
catgtgaacgagctgcctgagggtcatggaccggttaccgtcaacatcaatgatggcgtg
ttaggtctcggatcaaattcctggggcagcgaggtgcttgattcgtaccgtattcgattt
gaggattgtgcgttctcctttacgctgacgccgattcacgacgacgaacacgtcagccgc
aatccgaactgtggtgcgggtgcagccggtaaggaggtgcagtga

DBGET integrated database retrieval system