KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_1812Help
Entry
HMPREF9228_1812   CDS       T01844                                 

Gene name
proB_2
Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:bbv00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HMPREF9228_1812 (proB_2)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    HMPREF9228_1812 (proB_2)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    HMPREF9228_1812 (proB_2)
Enzymes [BR:bbv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     HMPREF9228_1812 (proB_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2056466..2057749)
Genome map
AA seq 427 aa AA seqDB search
MATANPPTIAHRKNNEVAPAGESCRAQRDGGSPGRLQIDSSTVGGGIGKQMSTPSQAEVR
RMIAAAGTIVVKVGSSSLTQPSGHLDPDKLDALTAALAQVRLMGARVVLVSSGAIAAGFG
PLGFDERPADVATQQATAAVGQGLLMARYEAAFGRFGIRVGQILITAEDTIRATQYRNVE
RTLDRLLDLGVVPIINENDSLASNEIRFGDNDRLSALVANLVRAEALVLLTDVDALYTAP
PAQPGSRRVEYVPNVIDALGDIQVSGSGSKVGTGGMVTKLEAARVAAVSGIPTVLTCASN
AGPAMMGDPVGTVFAPVKARGSSRRLWIGFAAEPRGTIVVDAGAAKAIRGGRASLLAAGA
LDVHGDFSAGDPVWIDDESGTHLARGLAGFDSEEIPQTLGRNTAQLKRFLGDQYAHPLVH
RDNLVLV
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
ttggccacggcgaatccgccgacgatagcgcatcggaagaataatgaagttgctcccgcc
ggcgagagctgccgagcacagcgagacgggggtagtcctggtcggctgcagattgacagc
tccaccgtcggaggcggaattggaaagcaaatgagcacaccaagtcaggccgaggtacgg
cgcatgatcgccgctgccggcactatcgtcgtcaaggtcggatctagctccctgacccag
ccgagcgggcacctcgaccctgacaagctcgacgctcttaccgccgcattggcgcaggta
cggctgatgggtgcccgtgtggtgctggtctcttccggtgctatcgccgcgggttttggc
ccgttgggctttgatgagcgaccggctgatgtggctacccagcaggccactgccgccgtg
ggacaaggcctgctgatggcccgctatgaagctgccttcggccggttcggtattcgggtg
ggacagattctgatcaccgcggaagacacgattcgagccacccagtaccgcaacgtggaa
cgtacgctggatcggctgctcgatctgggcgtggtgccgattatcaatgagaacgactcg
ctggcctccaacgagattcgtttcggcgataacgaccggttgtctgctttggtggccaat
ctggtgcgtgccgaagcgttggtattgctcaccgacgtggatgcgctgtacaccgcaccg
cctgctcagcccggatcgcgccgcgtggaatatgtgcccaacgtaatcgacgcgctgggc
gatatccaggtgtccggctcggggtccaaagtcggcaccggtggcatggtcacgaaactt
gaggctgctcgtgtggcggccgtttccggtattcctaccgtgctgacgtgcgcttcgaat
gcaggccccgcaatgatgggcgatccggtgggcacggtgtttgccccggtcaaggcccgt
ggatcttcgcgccgcctatggattggttttgcggctgaaccgcgcggcacgattgtggtt
gatgcgggtgcagccaaggccattcgtggtggtcgggcatcgttgctggccgccggcgct
ctcgatgtgcatggcgatttttccgccggcgatcctgtatggatcgatgacgaatccggc
acgcatctggcccgtggcctggccggcttcgactccgaagagattccgcagacgctcggt
cgcaacacggcccagctcaagcggttcttgggcgatcagtacgcgcacccgctcgtgcat
cgcgacaatcttgtactggtgtaa

DBGET integrated database retrieval system