KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_1909Help
Entry
HMPREF9228_1909   CDS       T01844                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:bbv00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    HMPREF9228_1909
Enzymes [BR:bbv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     HMPREF9228_1909
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2177925..2180030
Genome map
AA seq 701 aa AA seqDB search
MTDTMAHTQPASPASPAPTITAPGGRFVFGGDWNPEQWDESTWADDIAKLERAGINEATI
NVFSWALIQPDESRYDFAMLDRIVDLLVAHDFGFVLATSTGALPAWIAQRYPDATRTDYE
GRRHRFGVRHNACPNSPNFLRLAGALAGKLAERYGANDHLIAWHISNELGGRCYCDNCAA
AFRVWLERKYGSIEALNRAWNANFWSHTYADFAQILPPNAISDGLDGERATLSACSIDYK
RFQSDSLLGTYVTERDAIRAFDAMHPITTNLMDTYEGADYFRWGREMDVISWDDYPFPHT
TPSDNAFKHDLMRGVGDGRPFMLMESTPNQTNWQECNVLRAPGRMRAESYQAVAHGADTV
QYFQLKQSRGGFEKYHGAVISHGGREDERVYGEVRAIGGELAAHGARFVGGLTEAPVALM
FDWDSYWSTENISLLPKGFDYPDQVRRWYAPFHHRNIAVDVVPEDIDAGRLAGYRVLVAP
ALMMAKPGVRELVEGFVRAGGTFLATVMAGMHDEHDNVILGGYPGAFREVCGMRMEEMDM
IPDGRDVRVVFGSGEGEDADGSRVSLVAGLIKLDGGARPLAAYAGDVFYRGTPAVTVNDF
GAGTAYFAGAVLDEAGMDAVVGDVVRRAGVTGIVSPEPVEVVTRRYPSRGESLTFVINHA
DTATAWQDTPFAGCESVLDGTVLGRDLVLEPYGVTVVRTAA
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacaccatggcacacacacaacccgcatcacccgcatcacccgcaccgaccatc
accgcaccgggcggccgcttcgtcttcggcggcgactggaaccccgagcagtgggacgaa
tccacttgggcggacgacatcgccaaactcgaacgcgccggcatcaacgaggccaccatc
aacgtgttctcctgggcgctgatccagccggacgagagccgctacgacttcgccatgctc
gaccgcatcgtcgacctgctggtcgcgcacgacttcggcttcgtcctggccacgtccacc
ggcgcgctacccgcatggatcgcgcaacgctaccccgacgccacgcgcaccgactacgaa
ggccgtcgccaccgcttcggcgtgcggcacaacgcctgcccgaattcgccgaacttcctg
cgcctggccggcgcgctggccggcaagctcgccgaacgctacggcgccaacgaccatctg
atcgcctggcacatctccaacgagctcggcggccgctgctactgcgacaactgcgccgcc
gccttccgcgtctggctcgaacgcaagtacggttcgatcgaggcgttgaaccgcgcgtgg
aacgcgaacttctggagccacacctacgccgatttcgcccagatcctaccgccgaacgcg
atcagcgacggactggacggcgagcgcgccactctgtccgcctgcagcatcgactacaag
cggttccagtccgactcgctgctgggcacctacgtcaccgagcgcgacgcgatccgcgcg
ttcgacgcgatgcatccgatcaccacgaacctcatggacacctacgagggtgccgattat
ttccgttgggggcgcgagatggacgtgatcagctgggacgattatccgttcccgcacacc
acgccttccgacaatgcgttcaagcacgatctgatgcgcggcgtgggcgacggcaggccg
ttcatgctcatggagtcgacgccgaaccagacgaactggcaggagtgcaacgtactgcgc
gcgcccgggcgaatgcgtgcggaaagctatcaggcggtcgcgcatggcgcggataccgtg
cagtatttccagctcaagcagtcgcgcggcgggttcgagaagtaccatggcgcggtgatc
tcgcacggcgggcgcgaggacgagcgcgtgtacggcgaggtgcgtgcgatcggcggcgag
ctggcggcgcacggcgcgcggttcgtgggcggtctgaccgaggcgccggtcgcgctgatg
ttcgactgggattcgtattggtcgaccgagaacatctcgttgctgccgaagggcttcgac
tatccggatcaggtgcggcgctggtatgcgccgttccaccaccgcaacatcgcggtggat
gtggtgccggaagacattgacgccgggcggctggcgggctatcgcgtgctggtcgcgccg
gcgctcatgatggccaagccgggcgttcgtgagctggtcgaggggttcgtgcgcgccggc
ggcacgttcctggcgacggtgatggcaggcatgcacgacgagcatgacaacgtgatcctc
ggcggatacccgggcgcgttccgtgaggtgtgcggcatgcgcatggaggagatggacatg
atcccggacggccgcgacgtgcgtgtcgtgttcggttcgggcgagggcgaggacgcggac
gggtcccgggtctcgctggttgccgggctgatcaagctcgacggcggggcgcgcccgctg
gcggcctacgccggcgacgtgttctaccgaggtacgccggcggtgacggtgaacgatttc
ggcgcgggcacggcgtatttcgccggtgcggtgctggacgaggccggcatggacgccgtg
gtcggcgacgtggtgcgccgggccggcgttaccggcatcgtctcgccggagccggtggag
gtggttacgcggcggtacccgtcacgcggggagtcattgacgttcgtgatcaaccatgcg
gatacggccacggcgtggcaggatacgccgttcgccggatgcgagtcggtgcttgacggc
acggtactgggcagggatctggtgctggagccgtacggcgtgacggtggtgcgcaccgcg
gcatga

DBGET integrated database retrieval system