KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_2008Help
Entry
HMPREF9228_2008   CDS       T01844                                 

Definition
GHMP kinase C-terminal domain protein
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bbv00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HMPREF9228_2008
Enzymes [BR:bbv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     HMPREF9228_2008
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2309989..2310936
Genome map
AA seq 315 aa AA seqDB search
MIPVAVRQRPAYDDQLDEPAALTVRVDCPAKTNLTLEVGPTHDEWGGRHELDTIYCAIGV
YDTITATAKHPGAGFSLELEGAHLGDLASSSSDMRRNHAVLALFAMAQAAGRDSDVALTI
TKRIPVGAGLGGGSADAAATILAVNQLWELHWPMERLRTIAATLGADMPFCLSGGFAHGT
GFGERIEVIDAGSAAERDLIGQGYAGEVLVGAYQSQLSTPEVYHTFDAVGPGNGNRNHLQ
AAAISLHPRSGQAIDAAVNAGARHAFVSGSGPSVVAFVPDSTTAQRIIDAWRNGGMVDRI
IKASAPAHPIIGVSQ
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgattccggtagccgtccgtcaacgccccgcttatgacgatcaattggatgagccggca
gcactgaccgtgcgcgtggattgcccggccaagaccaacctcaccctggaggtcggcccg
acgcacgatgaatggggcggtcgtcacgaactggacaccatctactgtgccatcggggta
tatgacaccattaccgccaccgccaaacatccgggagccggcttctcgctggaactcgaa
ggcgcgcatctgggcgatttggcctcatccagcagtgacatgcgccgcaaccacgcggtc
ctggcattattcgccatggcccaggcggccggccgcgattccgatgtggcattgaccatc
accaaacgcatccccgtaggcgccggtctcggcggcggctcggcagacgcggccgcaacc
atactggccgtcaatcagctatgggaattgcactggccaatggaacgtctgcgtaccatt
gccgccacactgggcgctgatatgccattctgtctgtccggcgggttcgcgcacggcacc
ggattcggcgaacgcatcgaggtcattgatgcgggcagtgccgcagaacgcgatctcatc
ggccaaggatatgccggagaggtactggtcggcgcgtatcagtcgcagctcagcactccc
gaggtgtatcacacgtttgatgcggtcggtcccggcaatggcaatcgcaatcatctgcag
gcggcggccatcagtctgcatccgcgcagtggtcaggccattgacgccgctgtgaacgcc
ggtgcccgtcatgcattcgtctccggttccgggccgtcggtggtggctttcgtaccggac
agcaccacagcgcagcgcattatcgacgcctggcgcaacggcggtatggtcgaccgcatt
atcaaggccagtgcaccagcgcaccccattatcggagtcagccagtaa

DBGET integrated database retrieval system