KEGG   Bdellovibrio bacteriovorus W: BDW_01240Help
Entry
BDW_01240         CDS       T03036                                 

Definition
phosphoenolpyruvate carboxylase
Orthology
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bbw  Bdellovibrio bacteriovorus W
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:bbw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BDW_01240
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BDW_01240
  Energy metabolism
   00680 Methane metabolism
    BDW_01240
Enzymes [BR:bbw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BDW_01240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
253796..256129
Genome map
AA seq 777 aa AA seqDB search
MDYLPKELTELVDWSVTNLGLVIRSEVGDELFRRIESIRRFVKTKEGQTAEGLLELKSDL
AKLNDENLLEMAHSFSLMLELINACESAYRVWRIRAEQGEELSFAGHGRLIHVLTAHPTE
SRNPHILPILENIQNLLIRRLTKPLQSQGKELFLLIKMAWLLPLSKQKRPSVMDEAEYIY
SLSLKPELIDLYLQYAKSYQSFYLRTWVGGDKDGHPGVDETTLAGSLSMSRGFLLEWLSI
KIQAEKKSLKPLESHQQAKQRAQKFQKELRDLETQLRNLKEVGVNDIKKVFRIKDRIGKM
QEDFVKEFGASSPFLSSVMMLLKIFPGLVVPIELREESALVHEAVEKPLSKLAISRMLRY
VKSISAGEYPRFYVRSLILSQCESANDMAAGVTLVQKVFKADLLPVVPLFESAHSLNMSD
KIIEEFLASKKRLEIVKKSWLGNLEVMVGYSDSAKENGAFPSRYFVYKALHKLSSVICSY
KMTPIFFHGSGGSIERGGGSVRQQTDWWPLSAMKTVKVTVQGEMIYRNYASPEILMRQMD
RFAESRDRLLSQDKEKRNGDEEVLQKMADFIKDMYRKTVHDESFLNMVELATPYSFLSNL
KTGSRPAKRQDSVTVEGLRAIPWVLCWTQTRTLFPTWWGVGSYWISCSEAAKGDLKKAFS
SSALFSSYIRVLSFTLKKVELEIFDLYLKSSSLAPEKVQEFSELFRKEYQKCLTAVREIT
GEEDLLWYRQWLGTSIELRSPLIHPLNIMQLIALERDEVKLLRESATGIASGMLTTG
NT seq 2334 nt NT seq  +upstreamnt  +downstreamnt
atggattatctacctaaagaacttacagaacttgtcgattggtccgttacaaatttaggc
ctcgtgattcgctccgaagtaggggacgaactctttcgtcggatcgaaagtattcgccgc
tttgttaaaaccaaagaaggtcaaacggccgaagggctgctggaactaaaaagcgacctt
gcgaaattaaacgatgagaatcttttagagatggctcattccttttctttgatgctggaa
ttaatcaacgcctgtgaatctgcgtatcgagtctggcgcattcgcgctgagcaaggggaa
gagctatcctttgcaggccatggtcgtttgattcatgtgttaacagcacaccctaccgaa
tccagaaatccccacatcctgccgattcttgaaaatattcaaaatcttttgatccgccga
ttgacgaaaccgttgcagtcacaggggaaagagctttttttacttattaagatggcgtgg
ctcttgcctttatcaaagcagaagcgtccttcggttatggatgaggcagagtacatttat
tctctttcgttaaagccagagttgattgatctttatttgcagtatgcaaagtcttatcag
tctttctatttaagaacttgggtaggtggggataaggatggtcaccctggggtggatgaa
actactttggccggaagtctttcgatgtctcgtggttttttactagagtggctatcaata
aagattcaggccgaaaaaaaatcattaaaacctttggagtctcatcagcaggctaagcaa
agggcgcagaaatttcaaaaagaactaagagatttggaaactcaactgcgcaaccttaaa
gaagtcggcgtgaatgatattaaaaaggtctttcgcattaaggatcgaatcggaaaaatg
caggaagacttcgtgaaagaatttggagcgagttcaccttttctttcttcggtgatgatg
ttgctaaaaatatttccgggtcttgttgtgcccattgagctgagagaggaaagtgccctc
gtacatgaagctgtagaaaagcctctttcgaaattagcgatcagtcgtatgcttcggtat
gtaaagagcatatccgctggggagtatcctcggttttatgtgcgcagtttaattcttagt
cagtgtgaatccgcgaacgatatggctgcgggtgtgactttggtgcaaaaagtttttaaa
gccgatcttttgccggtggtgcctctttttgaaagtgctcactccttgaatatgtcggat
aaaattatcgaggaatttctagcaagcaagaagcgccttgaaatagtgaagaagagttgg
cttggaaatctggaagtgatggtggggtattcggattctgccaaagaaaatggagctttt
ccttctcgctatttcgtttacaaagcattgcacaaactcagctcggttatttgttcttat
aagatgacgccgatattttttcacggttctggaggcagtattgaaagaggcggcggctct
gttcggcagcagacggattggtggccactttctgccatgaaaacggtgaaggtaacggtg
cagggagaaatgatctaccgcaattacgcaagtcccgagattttaatgcgacagatggat
cgctttgccgaatcgcgagatcgcctgctttctcaagataaagaaaaaagaaatggcgat
gaagaggttttgcaaaagatggcagacttcatcaaagatatgtatcgcaaaaccgttcac
gatgagagttttttaaacatggtggaactggctacgccttactctttcctctcaaattta
aagacaggatcgcgcccagcaaaaaggcaggactctgtaactgttgaaggactgcgagcg
attccttgggtgctctgctggactcagacgcgcactctttttccaacctggtggggagtg
ggaagctattggatatcatgctccgaagctgcgaagggagatctgaagaaagctttttca
agctcggcactttttagttcttatattcgggtcctttcgttcaccctcaaaaaagtagag
ttagagatttttgatctctatttgaagtcatcttctttagctccggaaaaggtgcaagaa
ttcagtgagctctttaggaaagagtatcaaaagtgtctcacggccgttcgtgagatcacc
ggagaagaagatctcctttggtaccgtcagtggctcggcactagcattgagctccgaagc
cctttgattcacccgcttaatattatgcagctgattgcgctcgagcgtgatgaggtgaag
cttttgcgagagtccgcaacaggcatcgcaagtggtatgctgaccactggctag

DBGET integrated database retrieval system