KEGG   Bdellovibrio bacteriovorus W: BDW_09270Help
Entry
BDW_09270         CDS       T03036                                 

Definition
putative phosphodiesterase/alkaline phosphatase D
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
bbw  Bdellovibrio bacteriovorus W
Pathway
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:bbw00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BDW_09270
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BDW_09270
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BDW_09270
Enzymes [BR:bbw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     BDW_09270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
Position
1956068..1957153
Genome map
AA seq 361 aa AA seqDB search
MKKLLASSLIFGLLLIGCSTPPATQENTQTQSLSDRYVSTIPSRGIDYGKALNTVAFGSC
AHQGQPQPIWSTVAQNSPELFLAMGDNIYASLPHEKPISSQYRILDQIAEYRKIRSEVPF
LATWDDHDFGERDGGADFIGKQSSQIDFMNYWTYMKNSIPLEQAGIYHSKVIGPKKQAVQ
VIMLDTRFHRTPLLEKEGNEGKAYDYLPSEGTLLGETQWQWLEEQFKRPADLRLIVSSIQ
LIADDPKFEKWGNFPKERERFFALLKKYKIRNAIILSGDRHIASIAKMDIKGLGPLYEVT
ASSLNRPSKYTDADSHYIGKTYSQENFGLAHIDWKKRKVKLEVRNMQNEVVNQSEVTLPK
K
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactcttggcctctagcctcatctttggactgttgctgatcggttgcagcacc
cctccagcaactcaagaaaatactcagacgcaatctctttctgatcgttacgtctccacg
attccctcacgcggaattgactatgggaaagctttaaacacggtggcttttggctcttgc
gctcatcaaggacaacctcaaccaatctggtcaacggttgctcaaaactctccagaactc
tttttagccatgggagataatatttacgcaagccttccccatgaaaaacccatctcctct
caatatcgaattttagatcagattgcagaatatagaaaaattcgcagcgaagtcccgttc
ttagccacttgggatgatcatgattttggtgagcgtgacggcggagcggactttatcggc
aaacaatcttcgcaaattgatttcatgaactattggacttatatgaagaactctatccct
ctggagcaggcagggatttatcattcaaaagtcatcggacctaagaagcaagcggttcaa
gtgattatgcttgatacacgctttcatcgcacgcctcttttagaaaaagaaggcaatgaa
ggtaaagcctatgattacctcccttcagaaggaactcttttaggcgaaactcagtggcaa
tggcttgaagaacaatttaaaaggcccgccgatctcagactgattgtttccagtattcaa
cttattgccgatgatcccaagtttgaaaaatggggaaacttcccaaaagagcgcgagaga
ttctttgctcttttaaaaaaatataaaatccgcaatgccatcattctgagtggtgatcgt
catatcgctagtatcgcaaaaatggacatcaagggtcttggtcctctttatgaggtgaca
gcaagctctttaaatcgcccttcaaagtacaccgatgcagactctcattatatcggcaaa
acttatagccaagaaaactttggacttgcgcacattgattggaaaaagcgcaaggtaaag
cttgaggtgcgcaatatgcaaaatgaagtcgtgaatcaaagcgaagtcactctgcctaag
aagtaa

DBGET integrated database retrieval system