KEGG   Bdellovibrio bacteriovorus W: BDW_11260Help
Entry
BDW_11260         CDS       T03036                                 

Definition
acyl-CoA desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
bbw  Bdellovibrio bacteriovorus W
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bbw00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    BDW_11260
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    BDW_11260
Enzymes [BR:bbw01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     BDW_11260
Lipid biosynthesis proteins [BR:bbw01004]
 Desaturase
  First
   BDW_11260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
2374940..2376061
Genome map
AA seq 373 aa AA seqDB search
MNKKRIEWPVALFLVLNPLITIALLPVYFYFYGFQWQVFAFALVFAAATNLSITAGYHRL
FSHKSYDAHPIAKALFLLIGASGFQGSALKWSSDHRRHHTHIDGEKDPYNINEGFWYAHM
GWLFYKDSVDQKIHAPDLEKDWMVKFQHKYFAPLAIVMGFVLPGLITYWMVGNFFGGFVV
AGGLRIFLTQQSTFFVNSLCHTLGKQTYSKEISARDSWFVAILTHGEGYHNFHHKFQIDY
RNGIKWYHWDPTKWVIRSLNFMGLATKLRQISNVEILKARLQAESAQMTKHGFAEDQLQA
MREKILEAQNKMKKLREDYEQFKLDTAKRRDELKEAYDLKVLQFKHDMEIAKLEFRVGMK
QWRMHLQQVRSVS
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaaaacgaattgaatggccggtggctctttttctggtgttaaatcctctgatc
accatcgccctattacccgtctatttttacttttatggttttcaatggcaagtcttcgca
ttcgcactcgtgtttgcggcagctacgaatctaagcatcacagctggttatcaccgactg
ttttctcataaaagttatgatgcacatccaattgcaaaagcgctttttctattgatcggt
gcttcgggatttcaaggctcggctttgaaatggtcttcggatcaccgtcgtcaccataca
catatcgatggcgagaaagatccttacaacatcaatgagggcttttggtatgctcacatg
ggttggttgttttataaggactctgtagatcaaaagatccacgcccctgatcttgaaaaa
gattggatggtaaagtttcaacacaaatactttgctcctttagcaattgtgatgggcttt
gttttacctggtttgatcacttactggatggtaggaaatttcttcggcggttttgttgtt
gcgggagggttaagaattttcctcactcaacaaagcacattctttgtaaactctctttgc
cacactcttggaaagcaaacttactctaaagagatctctgcaagagactcttggtttgta
gcgatccttacccatggcgaaggctaccataacttccatcataagtttcaaatcgactac
cgtaatgggatcaagtggtatcactgggacccaacaaaatgggtaattcgctctttgaac
ttcatgggccttgcaacgaagcttcgtcagatttcaaacgttgaaatcttaaaagcacgc
ctgcaagcagaatctgcgcagatgacaaagcatggttttgctgaagatcaactgcaagct
atgcgcgagaaaatcctagaagctcagaacaaaatgaagaaacttcgtgaggactatgag
cagtttaaattagatactgctaaacgcagagatgagcttaaagaagcttacgacctcaaa
gtgcttcagttcaaacacgacatggaaattgctaagttagagttccgagtcggtatgaag
caatggcgcatgcacttgcaacaagttcgttcggtgtcttaa

DBGET integrated database retrieval system