KEGG   Borrelia burgdorferi ZS7: BbuZS7_0023Help
Entry
BbuZS7_0023       CDS       T00807                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA (EC:3.6.1.-)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bbz  Borrelia burgdorferi ZS7
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bbz03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(22098..22691)
Genome map
AA seq 197 aa AA seqDB search
MINKIHGKVIEKKESSLVLMTTVFEFELLVSAFCLANFNLSDKVELFTYLYTRENELKLF
GFLNSDEREIFKELIGVSGVGPRAALRVLSNIRYNEFKEAIDKEDIELVSKIKGIGKKMA
GKMFLHLQGKLLINSELESTGLFRFKELEESIVSMGFDRKIVNSKIREAFNLAEFANLKD
SEKEQFLFKEVLKRISN
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgataaataagattcatggtaaagttatagaaaaaaaagaatctagtttagttttaatg
actactgtttttgaatttgaacttttagttagtgcattttgccttgctaattttaatttg
tcagacaaagttgagttatttacttatctttatactagagaaaatgaattaaaacttttt
ggatttttgaattcagatgaaagagagatctttaaggagcttattggagtaagcggagta
ggcccaagggccgctttaagagtgttatccaatataaggtataatgagtttaaggaggct
attgacaaagaggatattgaacttgtctctaaaatcaaaggcattggcaaaaaaatggct
ggtaaaatgtttttacatcttcaaggtaagcttttgattaatagcgagcttgaatccact
ggtctttttagatttaaagaattagaagaatcaattgttagtatgggatttgatagaaaa
attgttaatagcaagattagagaggctttcaatttagctgaatttgcaaatttaaaagat
tctgaaaaggagcagtttttatttaaggaggttttaaaaagaatatcgaattaa

DBGET integrated database retrieval system