KEGG   Borrelia burgdorferi ZS7: BbuZS7_0056Help
Entry
BbuZS7_0056       CDS       T00807                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bbz  Borrelia burgdorferi ZS7
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bbz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BbuZS7_0056 (tpiA)
   01230 Biosynthesis of amino acids
    BbuZS7_0056 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BbuZS7_0056 (tpiA)
   00051 Fructose and mannose metabolism
    BbuZS7_0056 (tpiA)
   00562 Inositol phosphate metabolism
    BbuZS7_0056 (tpiA)
Enzymes [BR:bbz01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BbuZS7_0056 (tpiA)
Exosome [BR:bbz04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BbuZS7_0056 (tpiA)
  Exosomal proteins of bladder cancer cells
   BbuZS7_0056 (tpiA)
  Exosomal proteins of melanoma cells
   BbuZS7_0056 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(50442..51203)
Genome map
AA seq 253 aa AA seqDB search
MRKTFLAGNWKMHYTSAEASIVAKKIATEVKTLKDDVVIMITPPFTALSKVSECIKGSNI
LLGAQNMSYMESGARTSEISPSMLLEFGVEYVILGHSECRLYLAETDEIINKKILAGLKH
PFKYLILCVGETLDERDSGKTLEVVLNQVKKGLNCVSESDIQRIILAYEPVWAIGTGKTA
TKEEAEEVHKAIRLEITKLYSKSASDNIIIQYGGSVNSNNVKELMNEPNIDGALIGGASL
KAESFLSIINNVL
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaacatttttagcgggaaattggaaaatgcattatacaagtgcagaagcttct
attgttgcaaaaaaaattgcaactgaggttaagaccttaaaagatgatgttgtaataatg
ataactcctccatttacggctttatctaaggtttcagaatgtattaagggtagtaacatt
cttcttggtgctcaaaatatgtcttatatggaaagtggagcaaggacaagtgaaatttca
ccttcaatgcttttagaatttggagtagaatatgttatacttggtcattctgaatgtagg
ttgtatttagcagaaacagatgaaataataaataaaaagattcttgcaggacttaagcat
cctttcaaatacttaattctttgtgttggagaaactcttgatgaaagagattctggaaaa
actttagaggttgttttaaatcaggttaaaaaggggttaaattgtgtttctgaatcagat
attcaaaggataattttagcttacgaacctgtttgggcaattggaacgggtaaaaccgca
actaaagaagaggcagaagaggttcataaggcaattaggcttgagattacgaagctttat
tcaaagtcagcttcagacaatattataattcagtatggaggctctgttaattcaaacaat
gtaaaagagcttatgaatgagcctaatattgatggtgcgctaataggtggagcatcttta
aaggccgaatcttttttatctataattaacaatgttctttag

DBGET integrated database retrieval system