KEGG   Borrelia burgdorferi ZS7: BbuZS7_0210Help
Entry
BbuZS7_0210       CDS       T00807                                 

Gene name
galU
Definition
UDP-glucose pyrophosphorylase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bbz  Borrelia burgdorferi ZS7
Pathway
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bbz00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BbuZS7_0210 (galU)
   00052 Galactose metabolism
    BbuZS7_0210 (galU)
   00500 Starch and sucrose metabolism
    BbuZS7_0210 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    BbuZS7_0210 (galU)
Enzymes [BR:bbz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BbuZS7_0210 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
208297..209238
Genome map
AA seq 313 aa AA seqDB search
MPELTYINKNFKTILKNNEYIKLNFCYNLILREKNMKGIILAAGYGTRFLPITKTIPKEM
LPILNKPAIDYIIQEFIDSGIKDILLISSRRKKVLEDYFDREIELENIFLKENKKDELEK
IRSKKINISFIRQKEMLGTGNALLYAKPWINREPVVVAYPDDLCIGNPPLSLQLIKLYEK
TGKNIISIIENPENINRYGVIDLYKDEIHVKNIIEKPKIGSEPSNKASIGRFLYNYEFFE
HLEEGFKLHKKGEYYHIYALKKLMDQKKVLYKNIEGKRIDIGTLEGYLEAIINSAKKDKK
LMGIIKKGINEND
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
ttgcccgaacttacatacataaataaaaattttaaaacaattttaaaaaacaatgaatat
ataaaattaaatttttgctataatcttattttaagagagaaaaatatgaaaggcattatt
ctggcagctgggtatggaacaagatttttaccaataacaaaaacaattccaaaagaaatg
ctaccaattttaaacaagccagccatagattatattattcaagaatttatcgattcagga
ataaaagatattttattaataagctcaagaagaaaaaaagttcttgaagattattttgac
agagaaattgaacttgaaaatatttttttaaaagaaaataaaaaagatgaattagaaaag
attagaagcaaaaaaatcaacataagcttcataagacaaaaagaaatgctaggcacagga
aatgccctactttatgcaaaaccctggataaatagagagcctgtagttgtagcttaccct
gacgatctttgcattggaaatccaccattaagcttgcaattgatcaaactttatgaaaaa
actggaaagaacataatatctatcattgaaaatccagaaaatataaatagatacggagta
atagatctctacaaagacgaaatccatgtaaaaaacattattgaaaaaccaaagattgga
agtgagcctagcaataaagcatctattggaagatttttgtacaattatgagttttttgaa
catttagaagaaggattcaaactacataaaaaaggtgaatactatcacatttatgcttta
aaaaagctaatggatcaaaaaaaagtattatataaaaacattgaagggaaaagaattgac
ataggaactcttgagggttatctagaggcaataataaattctgccaaaaaagataaaaaa
ttaatgggaattatcaaaaaaggaataaatgaaaacgattaa

DBGET integrated database retrieval system