KEGG   Borrelia burgdorferi ZS7: BbuZS7_0210Help
Entry
BbuZS7_0210       CDS       T00807                                 

Gene name
galU
Definition
UDP-glucose pyrophosphorylase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bbz  Borrelia burgdorferi ZS7
Pathway
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bbz00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bbz00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bbz00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
208297..209238
Genome map
AA seq 313 aa AA seqDB search
MPELTYINKNFKTILKNNEYIKLNFCYNLILREKNMKGIILAAGYGTRFLPITKTIPKEM
LPILNKPAIDYIIQEFIDSGIKDILLISSRRKKVLEDYFDREIELENIFLKENKKDELEK
IRSKKINISFIRQKEMLGTGNALLYAKPWINREPVVVAYPDDLCIGNPPLSLQLIKLYEK
TGKNIISIIENPENINRYGVIDLYKDEIHVKNIIEKPKIGSEPSNKASIGRFLYNYEFFE
HLEEGFKLHKKGEYYHIYALKKLMDQKKVLYKNIEGKRIDIGTLEGYLEAIINSAKKDKK
LMGIIKKGINEND
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
ttgcccgaacttacatacataaataaaaattttaaaacaattttaaaaaacaatgaatat
ataaaattaaatttttgctataatcttattttaagagagaaaaatatgaaaggcattatt
ctggcagctgggtatggaacaagatttttaccaataacaaaaacaattccaaaagaaatg
ctaccaattttaaacaagccagccatagattatattattcaagaatttatcgattcagga
ataaaagatattttattaataagctcaagaagaaaaaaagttcttgaagattattttgac
agagaaattgaacttgaaaatatttttttaaaagaaaataaaaaagatgaattagaaaag
attagaagcaaaaaaatcaacataagcttcataagacaaaaagaaatgctaggcacagga
aatgccctactttatgcaaaaccctggataaatagagagcctgtagttgtagcttaccct
gacgatctttgcattggaaatccaccattaagcttgcaattgatcaaactttatgaaaaa
actggaaagaacataatatctatcattgaaaatccagaaaatataaatagatacggagta
atagatctctacaaagacgaaatccatgtaaaaaacattattgaaaaaccaaagattgga
agtgagcctagcaataaagcatctattggaagatttttgtacaattatgagttttttgaa
catttagaagaaggattcaaactacataaaaaaggtgaatactatcacatttatgcttta
aaaaagctaatggatcaaaaaaaagtattatataaaaacattgaagggaaaagaattgac
ataggaactcttgagggttatctagaggcaataataaattctgccaaaaaagataaaaaa
ttaatgggaattatcaaaaaaggaataaatgaaaacgattaa

DBGET integrated database retrieval system