KEGG   Borrelia burgdorferi ZS7: BbuZS7_0678Help
Entry
BbuZS7_0678       CDS       T00807                                 

Gene name
gpmA
Definition
phosphoglyceromutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bbz  Borrelia burgdorferi ZS7
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bbz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BbuZS7_0678 (gpmA)
   01230 Biosynthesis of amino acids
    BbuZS7_0678 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BbuZS7_0678 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    BbuZS7_0678 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BbuZS7_0678 (gpmA)
Enzymes [BR:bbz01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BbuZS7_0678 (gpmA)
Exosome [BR:bbz04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BbuZS7_0678 (gpmA)
  Exosomal proteins of melanoma cells
   BbuZS7_0678 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
693590..694336
Genome map
AA seq 248 aa AA seqDB search
MYKLVLVRHGESEWNKENLFTGWTDVKLSDKGIDEAVEAGLLLKQEGYSFDIAFSSLLSR
ANDTLNIILRELGQSYISVKKTWRLNERHYGALQGLNKSETAAKYGEDKVLIWRRSYDVP
PMSLDESDDRHPIKDPRYKHIPKRELPSTECLKDTVARVIPYWTDEIAKEVLEGKKVIVA
AHGNSLRALVKYFDNLSEEDVLKLNIPTGIPLVYELDKDLNPIKHYYLGDESKIKKAMES
VASQGKLK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtataaattagttttagtaagacacggagagagtgagtggaataaagaaaatcttttt
actggttggacagatgttaaactttctgacaagggtatcgatgaggctgttgaggcgggt
ttgcttctcaaacaagaaggctattcttttgatattgcttttagttctttgttgtcaaga
gctaatgacactttaaatattattttgcgagaattagggcaatcttatattagtgtaaaa
aaaacctggagattaaatgaaaggcactatggagctttgcaaggtttaaataagtcagaa
acagctgcaaaatatggggaagataaggttttaatttggagacgtagttatgatgtgccc
ccaatgtctttggatgagtctgatgatcgtcatcccataaaagatccaagatataaacat
atccccaaaagggaacttccttcaacagagtgccttaaagatactgttgcaagagttatt
ccttattggactgatgagattgcaaaagaagttcttgaaggtaaaaaagttattgttgct
gctcacggtaattctttaagagcgcttgttaaatattttgacaatttaagtgaagaagat
gttttaaagcttaacattcccacaggcattcctttagtttacgaattagataaagattta
aatcccattaaacattactatctaggtgatgagagcaaaattaaaaaggcaatggaatct
gttgctagtcaaggaaagttaaagtaa

DBGET integrated database retrieval system