KEGG   Borrelia burgdorferi ZS7: BbuZS7_0678Help
Entry
BbuZS7_0678       CDS       T00807                                 

Gene name
gpmA
Definition
phosphoglyceromutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bbz  Borrelia burgdorferi ZS7
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:bbz01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:bbz01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bbz00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:bbz00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:bbz00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
693590..694336
Genome map
AA seq 248 aa AA seqDB search
MYKLVLVRHGESEWNKENLFTGWTDVKLSDKGIDEAVEAGLLLKQEGYSFDIAFSSLLSR
ANDTLNIILRELGQSYISVKKTWRLNERHYGALQGLNKSETAAKYGEDKVLIWRRSYDVP
PMSLDESDDRHPIKDPRYKHIPKRELPSTECLKDTVARVIPYWTDEIAKEVLEGKKVIVA
AHGNSLRALVKYFDNLSEEDVLKLNIPTGIPLVYELDKDLNPIKHYYLGDESKIKKAMES
VASQGKLK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtataaattagttttagtaagacacggagagagtgagtggaataaagaaaatcttttt
actggttggacagatgttaaactttctgacaagggtatcgatgaggctgttgaggcgggt
ttgcttctcaaacaagaaggctattcttttgatattgcttttagttctttgttgtcaaga
gctaatgacactttaaatattattttgcgagaattagggcaatcttatattagtgtaaaa
aaaacctggagattaaatgaaaggcactatggagctttgcaaggtttaaataagtcagaa
acagctgcaaaatatggggaagataaggttttaatttggagacgtagttatgatgtgccc
ccaatgtctttggatgagtctgatgatcgtcatcccataaaagatccaagatataaacat
atccccaaaagggaacttccttcaacagagtgccttaaagatactgttgcaagagttatt
ccttattggactgatgagattgcaaaagaagttcttgaaggtaaaaaagttattgttgct
gctcacggtaattctttaagagcgcttgttaaatattttgacaatttaagtgaagaagat
gttttaaagcttaacattcccacaggcattcctttagtttacgaattagataaagattta
aatcccattaaacattactatctaggtgatgagagcaaaattaaaaaggcaatggaatct
gttgctagtcaaggaaagttaaagtaa

DBGET integrated database retrieval system