KEGG   Borrelia burgdorferi ZS7: BbuZS7_0751Help
Entry
BbuZS7_0751       CDS       T00807                                 

Definition
diphosphate--fructose-6-phosphate 1-phosphotransferase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bbz  Borrelia burgdorferi ZS7
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:bbz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BbuZS7_0751
   01230 Biosynthesis of amino acids
    BbuZS7_0751
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BbuZS7_0751
   00030 Pentose phosphate pathway
    BbuZS7_0751
   00051 Fructose and mannose metabolism
    BbuZS7_0751
   00052 Galactose metabolism
    BbuZS7_0751
  Energy metabolism
   00680 Methane metabolism
    BbuZS7_0751
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    BbuZS7_0751
Enzymes [BR:bbz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BbuZS7_0751
Protein phosphatases and associated proteins [BR:bbz01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BbuZS7_0751
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
761375..762718
Genome map
AA seq 447 aa AA seqDB search
MYRIKNENLDFKIDSLGECKQNNPLIDFYASEGSSHFVNEKNKIKFSVYRNEDKGDKYED
VLLEKAGPREKIYFVPRHVKAAITTCGGLCPGFNDVIRSIVRTLWKIYGVRNIYGVKFGY
QGLLPESNSPFINLNPDVVDDINKFGGTILGSSRGGIKPVEIVDTLERMNINMIFNIGGD
GTQKGSLLIAEEIEKRNLKIAVVGIPKTVDNDFMFVQKSFGFETAVEQAVAAVAGAHFEA
NSAYNGIGLVKVMGRDSGFIAAHTALSSNDVNFCLIPELDFDIEGPNGFLVHLERRLLEK
ESLEEIPHAVILIAEGAGQKYFDHFPKKKDDSGNLLYEDIGLYIKDKITEYFKAKNIQFT
LKYIDPSYIIRSSPANASDSLYCARLGSNAVHAAMAGKTKMLISLWSTKFVHIPIKMAVI
DRNKVNPNGSFWRDVLSSTGQPISMKN
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
gtgtatagaattaaaaatgaaaatttagattttaaaatagatagcttgggagaatgcaag
caaaacaatcctttgattgatttttatgctagtgagggttcttcccattttgttaatgaa
aaaaataaaatcaagtttagtgtatataggaatgaggataagggagataagtatgaagat
gttcttttagaaaaagctgggcctagagaaaaaatttattttgtgcccaggcatgttaaa
gctgctattactacttgtggtgggctttgtcctggttttaacgatgttattcgctctatt
gtgcgaactttatggaaaatatatggggttcgcaatatttatggagtaaaatttggatat
caagggcttcttcctgagtcaaattcaccttttattaatcttaatccagatgttgttgat
gatattaataaatttggaggtactattcttggttcttcaaggggtggtattaagcctgtg
gaaatagttgatactttagagagaatgaacattaatatgatttttaacattggcggggat
ggtactcaaaaggggtctcttcttattgctgaggagatagaaaaaagaaatttaaaaata
gcagttgtgggcattcctaaaaccgtagacaatgattttatgtttgttcaaaaatctttt
ggatttgagactgctgtagaacaagctgttgcagctgttgctggtgctcattttgaagct
aatagtgcttataatggcattggacttgttaaagttatgggacgggattctggctttatt
gctgctcataccgcactttcttctaatgatgttaatttttgtttaatcccagaacttgat
tttgacatagaaggtcctaatggatttcttgttcatcttgaaagacgacttttagagaaa
gaaagcttagaagagattccccatgcagtaatattgatagcagaaggagcaggccaaaaa
tattttgatcattttcctaagaagaaagacgattctgggaatttgctttatgaggatatt
gggctttatattaaagataaaattacagaatattttaaagcaaaaaatatacaatttact
cttaaatacattgatcccagctatattattagaagttcgcctgctaatgccagtgattcg
ctttattgtgctaggcttgggtcgaatgctgtgcatgctgcaatggctggtaagacaaaa
atgttgattagtttatggagtacaaaatttgttcatataccgattaagatggcagtaatt
gacagaaataaggttaatccaaatggttctttttggagagatgttctttcaagtacgggg
caaccaattagcatgaagaattaa

DBGET integrated database retrieval system