KEGG   Borrelia burgdorferi ZS7: BbuZS7_E15Help
Entry
BbuZS7_E15        CDS       T00807                                 

Gene name
pncA
Definition
pyrazinamidase/nicotinamidase, PncA protein (EC:3.-.-.-)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
bbz  Borrelia burgdorferi ZS7
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:bbz00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
ZS7_lp25:complement(15078..15614)
Genome map
AA seq 178 aa AA seqDB search
MPVSNSNEIISLINQLQNYFKNIIATKDWHCKNHVSFSNNKNGGIWPEHCVKNTWGSEFP
NDLNTKRIKKVFFKGTDQYYDSYSGFYDDCIKKKQTGLQLYLKNNSINTLFITGLALDFC
VKETILDAINLGFRVYLITDATRSITSTPELIIQELKKLNVLTCFSKDIFDSQSKLNI
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
ttgccagtatctaacagtaatgaaataatttctttgattaaccaacttcaaaattatttc
aaaaacattattgccaccaaggattggcattgtaaaaatcatgtaagcttttctaacaat
aaaaatgggggtatttggcctgagcactgcgtcaaaaatacttggggatcagaatttcct
aatgatctaaatacgaaaagaataaaaaaagttttttttaaaggaaccgatcaatattac
gatagttacagtggattttatgatgattgcattaaaaaaaaacaaacgggccttcagctt
tatctgaaaaacaattcaatcaatacattatttataacgggactagcattggatttttgt
gtaaaagaaacaatacttgatgcaattaacttgggatttcgagtttatctaataacagat
gctacaagaagcataacatctactcctgaattaataattcaggaacttaaaaagcttaat
gtattaacttgcttctccaaggacatcttcgacagccaaagtaagcttaatatataa

DBGET integrated database retrieval system