KEGG   Bacillus cereus ATCC 10987: BCE_0022Help
Entry
BCE_0022          CDS       T00162                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
bca  Bacillus cereus ATCC 10987
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bca00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BCE_0022 (recR)
DNA repair and recombination proteins [BR:bca03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      BCE_0022 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
27568..28164
Genome map
AA seq 198 aa AA seqDB search
MHYPEPISKLIDSFMKLPGIGPKTAVRLAFFVLDMKEDDVLGFAKALVNAKRDLAYCSVC
GHITDRDPCYICNDSHRDQSVVCVVQEPKDVIAMEKMKEYQGVYHVLRGAISPMEGIGPE
DINIPQLLKRLHDETVQEVILATNPNIEGEATAMYISRLLKPTGIKVTRIAHGLPVGGDL
EYADEVTLSKALEGRREV
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcattatccagaaccaatatcaaaactaattgatagttttatgaaattgccaggaatc
ggaccgaaaacagcggttcgattggcgtttttcgtattagatatgaaagaagatgatgtg
ttaggttttgcaaaagcacttgtaaatgcgaagcgagacttagcatattgttctgtatgc
gggcatattactgaccgtgacccttgttatatttgtaacgattcacatcgagatcaatca
gttgtttgtgtcgtgcaagaaccgaaagatgtaatcgcgatggaaaagatgaaagagtat
caaggtgtatatcatgtgttacgtggtgctatctctccaatggagggaattggaccagaa
gacattaatatcccgcaacttctaaagcgactacacgatgaaacagtacaagaagtaata
ttagcaacaaatcctaatattgaaggggaagctacagcgatgtatatatcccgcctctta
aagccgacaggtattaaagtaactcgtattgcacacggtctgccagttggtggagattta
gaatatgcagatgaagtgacactgtcgaaagcattagaaggtcgtagagaagtataa

DBGET integrated database retrieval system