KEGG   Bacillus cereus ATCC 10987: BCE_0061Help
Entry
BCE_0061          CDS       T00162                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K04075  tRNA(Ile)-lysidine synthase [EC:6.3.4.19]
Organism
bca  Bacillus cereus ATCC 10987
Brite
Enzymes [BR:bca01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.19  tRNAIle-lysidine synthase
     BCE_0061
Transfer RNA biogenesis [BR:bca03016]
 Prokaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    BCE_0061
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP_bind_3 TilS_C TilS PAPS_reduct tRNA_Me_trans NAD_synthase QueC RcbX ThiI Usp
Motif
Other DBs
NCBI-ProteinID: AAS38997
UniProt: Q73FE5
Position
67554..68984
Genome map
AA seq 476 aa AA seqDB search
MKDTFVEKVDDFVKQHDVLKERSTIVVGVSGGPDSVALLYYLLEKRAAKQFEIVVAHVDH
MFRGDESHEDLQFVQDLCKELGVICETIRINVSQYQQQYGMNAQVAARECRYAFLERIMK
KYDARYVALGHHGDDQVETILMRLVRGSTPKGYAGIAVKRPFHNGYLIRPLLGVTKEEIV
DYCHKLKIIPRIDPSNKKEVYTRNRLRKYVLPHLKEENPQVHEKFQKFSMQMQEDEAYLQ
ELAFEKMNKVITKKSDKQISLSIPAFESMSMPLQRRGIQLILNYLYEYKIPSSLSSIHID
KVIEFFKRTQPSGSLDFPGDLKIVRAYEECSFGFKQEIVSPFLQDLSVPGTITLSNGDKL
VTEVSEDIPSNMNETVFVAKYNDISYPLRIRSRENGDRMSIQGMNGTKKIKAIFIEAKVP
REKREEWPVVCDARGNVIWLPLLKRSAFAISKETAKKDKYMIIHYKSKESSGRIMK
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagatacatttgttgaaaaggtagatgactttgtaaagcagcatgatgtattaaag
gaacgctcaacaattgttgtaggtgtttctggtggtcctgactctgtggctcttctatat
tatttgttagaaaaaagagcagcaaaacagtttgagattgtagtggcgcatgtggatcat
atgtttcgaggtgatgaatctcatgaggacctacagtttgtgcaagacctttgtaaagag
ctaggagttatttgcgaaacgataaggattaatgtgtcgcaatatcaacagcaatacggg
atgaatgcacaagttgctgctagagaatgcagatatgcatttttggaaagaataatgaag
aaatatgatgcgaggtatgtagctcttggacatcatggtgatgatcaagtagagacaatt
ttaatgcgccttgtacgagggagtactccgaaaggatatgcaggcattgcagtgaagcgt
ccttttcataatgggtatttaattaggccgttacttggagtaacgaaggaagagattgtt
gattactgtcataagttaaaaataattcctcgtatagatccaagtaataaaaaggaagta
tatacaaggaatcgattacgtaaatatgttcttcctcatttgaaagaagaaaatccacaa
gtgcatgagaaattccaaaaatttagcatgcagatgcaagaggatgaggcgtatttgcag
gaattagcttttgagaaaatgaataaagtaattacaaaaaaaagtgataaacaaattagc
ttatcaattcctgcctttgaatccatgtctatgcctttacaaagaagagggattcaacta
atattaaactatctttatgaatataagattccatcttctctttcctctatacatattgac
aaagtgattgagttttttaagcggacacaaccttcgggttcacttgatttcccaggtgat
ttaaaaattgttcgcgcatacgaggagtgcagctttggatttaaacaagaaattgtttcc
ccttttttacaagatttatcagtgcccgggacaattacgctatcgaacggggataagctt
gtaacagaggtgagcgaagatataccaagtaacatgaatgaaacagtttttgttgctaag
tataatgatatatcatatccacttcgtattcgttctagagaaaatggagatcgcatgtca
atacaaggtatgaatggcaccaaaaagataaaagctatttttatcgaagcgaaagtacca
agagaaaaaagagaagaatggccggtcgtttgtgatgcaagagggaatgttatttggtta
cccttgttgaagcgatctgcatttgctatctcgaaagagacagcaaagaaggataaatat
atgattattcactacaaaagcaaggagtcttccgggaggataatgaaatga

DBGET integrated database retrieval system