KEGG   Bacillus cereus ATCC 10987: BCE_0070Help
Entry
BCE_0070          CDS       T00162                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
bca  Bacillus cereus ATCC 10987
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bca00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BCE_0070 (folP)
Enzymes [BR:bca01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     BCE_0070 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
77503..78345
Genome map
AA seq 280 aa AA seqDB search
MCSLKWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSDGGSYNEVDAAVRHAKEMREEGA
HIIDIGGESTRPGFAKVSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAH
IINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVR
DENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEG
TGATVCLGIEKGCEFVRVHDVKEMARMAKMMDAMIGKGVK
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgtgtagtttgaagtgggattatgatttgcgctgcggcgaatatacattgaacttaaat
gaaaaaacgttaattatggggattttaaatgtaacaccagattcgttttctgatggtggg
agttacaacgaggtagatgctgcagtgcgccatgcgaaagaaatgcgagaagaaggtgct
catattattgatattggtggcgaatctactcgtccgggctttgctaaagtatcggtggaa
gaagaaataaaacgagttgttccaatgattcaggctgtttcaaaagaggtgaaattgcct
atttctatcgacacgtataaagctgaagttgcaaaacaagcaattgaagctggtgctcat
attattaatgatatttggggagcgaaggcggaaccaaaaatcgctgaagttgcagctcat
tacgatgtacctattatcttaatgcataatcgcgataatatgaattatcgtaatttaatg
gctgatatgattgctgacttatatgacagtattaaaattgctaaagatgctggtgtgcga
gatgagaatatcattttagacccaggtattggttttgctaaaacgcctgaacaaaattta
gaagcgatgcgtaatttagaacagttaaacgtactaggttatccagttctcttaggtact
tcgagaaagtcctttattgggcatgtgctagatttaccggtagaagaacgtcttgagggg
acgggagctaccgtttgtcttggtattgaaaagggttgtgagtttgttcgtgttcatgat
gtgaaggaaatggcgcgtatggctaagatgatggatgcgatgattggtaagggggtaaag
taa

DBGET integrated database retrieval system