KEGG   Bacillus cereus ATCC 10987: BCE_0072Help
Entry
BCE_0072          CDS       T00162                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
bca  Bacillus cereus ATCC 10987
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bca00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BCE_0072 (folK)
Enzymes [BR:bca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     BCE_0072 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
78705..79220
Genome map
AA seq 171 aa AA seqDB search
MNNIAYIALGSNIGERYTYLTEAIQFLNKNPYIKVEDVSSVYETEPVGYTDQSCFLNLVI
KISTNLSPQELLKVTQKVENDLGRKREIRWGPRTIDLDILLYNQENIEAENLIVPHPRMF
ERAFVIVPLLEINQDIKQNISRSQVEEMKRREGVTVWKQKNGEDAFVLFEN
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgaataatatagcttacattgcattaggttcaaatattggagaacgttatacgtattta
actgaagcgattcagtttctgaataaaaatccttatatcaaagttgaggatgtttcgtct
gtatatgagacggaaccggttggctatactgaccaaagttgctttttgaatttagttata
aaaatttctaccaatttatcaccgcaagaattattgaaagtaacgcaaaaagtagaaaat
gatctaggaagaaaaagggaaattaggtggggacctaggactatcgaccttgacatttta
ctatataatcaagaaaatattgaagcagagaatcttattgttccgcatccgcggatgttc
gaaagagcttttgttatcgttccgttgttagagattaatcaagatataaaacaaaacatt
tcacgttcacaagtagaagaaatgaaaaggcgagagggagtaacggtatggaagcagaaa
aatggggaagacgcattcgtgcttttcgaaaactaa

DBGET integrated database retrieval system