KEGG   Bacillus cereus ATCC 10987: BCE_0087Help
Entry
BCE_0087          CDS       T00162                                 

Gene name
gltX
Definition
glutamyl-tRNA synthetase (EC:6.1.1.17)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
bca  Bacillus cereus ATCC 10987
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:bca00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    BCE_0087 (gltX)
Enzymes [BR:bca01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     BCE_0087 (gltX)
Amino acid related enzymes [BR:bca01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   BCE_0087 (gltX)
Transfer RNA biogenesis [BR:bca03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    BCE_0087 (gltX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
97325..98782
Genome map
AA seq 485 aa AA seqDB search
MEKQVRVRYAPSPTGHLHIGNARTALFNYLFARHQDGKFIIRIEDTDVKRNVAGGEESQL
KYLKWLGMDWDEGVDVGGEFGPYRQTERLDIYKKLYEDLLERGLAYKCYMTEEELEAERE
GQIARGETPRYAGNHRDLTEAQVKEFEAEGRIPSIRFRVPADRDYTFKDIVKDEVAFHSN
DFGDFVIVKKDGIPTYNFAVAVDDHLMEITHVLRGDDHISNTPKQMMIYEAFGWDIPQFG
HMTLIVNESRKKLSKRDESIIQFIEQYKELGYLPEAIFNFIALLGWSPVGEEEIFSQEEF
IKMFDAARLSKSPALFDSQKLKWMNNQYMKKQDLDTVVELSLPHLVKAGRIGETLSEQEQ
AWIRDVIALYHEQMSFGAEIVELSEMFFKDHVDYEEEGQEVLKGEQVPEVLRAFAGQVEA
LEAMEPAAIKAAIKAVQKETGHKGKNLFMPIRVATTGQTHGPELPNAIALLGKEKVLXRL
QKVIG
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagcaagtgagagtgcgctatgcgccaagtccaacaggacacttacatatcgga
aatgcgcgtacggcattatttaattatttatttgctcgtcatcaagatggtaagtttatt
attcgtattgaagatactgatgtaaaacgtaatgttgctggtggagaagaaagccaatta
aaatacttgaaatggctcggtatggactgggatgaaggtgttgatgttggtggtgaattt
ggaccatatcgtcaaacagagcgtttagatatttataaaaagttatatgaagatttatta
gagcgtggtttagcttacaaatgttatatgacagaagaagaactagaagcagaacgcgaa
gggcaaattgctcgtggtgaaacacctcgttacgcaggtaaccaccgtgatttaactgaa
gcgcaagtgaaagaatttgaagctgagggacgtattccaagtattcgtttccgtgtacca
gctgaccgtgattacacatttaaagatattgtaaaagatgaagttgcattccattcaaat
gatttcggtgatttcgttattgtgaaaaaagatgggattccaacttataactttgcagta
gcagtagatgatcacttaatggaaattacacacgtgcttcgtggtgatgaccatatttca
aacactccaaaacaaatgatgatttatgaagctttcggttgggatattccacaattcggt
catatgactttaattgtaaatgaaagccgtaaaaaattaagtaagcgtgatgaatctatt
attcaatttattgagcaatataaagagcttggatatcttccagaagcaatctttaacttt
attgcattactaggttggtcgccagtaggagaagaagaaatcttctctcaagaagagttt
atcaaaatgttcgatgcagctcgtttatcaaaatcacctgcattatttgattctcaaaaa
ctaaaatggatgaacaaccaatatatgaaaaagcaagatttagatacggtagtagaatta
agcttaccgcatttagtgaaggctggacgtataggtgaaactttaagtgaacaagaacaa
gcgtggattcgtgatgtaattgcgttatatcatgaacaaatgagctttggagctgaaatt
gtagagctttctgaaatgttcttcaaagatcatgttgattatgaagaagaaggacaagaa
gtattaaaaggtgaacaagtaccagaagtacttcgtgcatttgctggtcaagtagaagca
ctagaagctatggaaccggcagcaattaaggcggctattaaggcagttcaaaaggaaaca
ggtcataaaggtaaaaacttatttatgccaatccgtgttgcaactacgggtcaaacacac
ggcccagagcttcctaatgctattgcacttcttggaaaagaaaaagttttaawtcgtctt
caaaaagtaattggttaa

DBGET integrated database retrieval system