KEGG   Bacillus cereus ATCC 10987: BCE_0154Help
Entry
BCE_0154          CDS       T00162                                 

Gene name
rocF
Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
bca  Bacillus cereus ATCC 10987
Pathway
bca00220  Arginine biosynthesis
bca00330  Arginine and proline metabolism
bca01100  Metabolic pathways
bca01110  Biosynthesis of secondary metabolites
bca01130  Biosynthesis of antibiotics
bca01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bca00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    BCE_0154 (rocF)
   00330 Arginine and proline metabolism
    BCE_0154 (rocF)
Enzymes [BR:bca01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     BCE_0154 (rocF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AAS39090
UniProt: Q73F53
Position
152609..153502
Genome map
AA seq 297 aa AA seqDB search
MKKEISVIGVPMDLGQMRRGVDMGPSAIRYAGVIERIEEIGYDVKDMGDICIEREKEVDV
NTSLRNLTQVATVCNELASKVDHIIEEGRFPLVLGGDHSIAIGTLAGVAKHYKNLGVIWY
DAHGDLNTEETSPSGNIHGMSLAASLGYGHPALVDLYGAYPKVKKENVVIIGARALDEGE
KDFIRNEGIKVFSMHEIDRMGMTAVMEETIAYLSHTDGVHLSLDLDGLDPHDAPGVGTPV
IGGLSYRESHLAMEMLAEADIVTSAEFVEVNTILDERNRTATTAVALMGSLFGEKLK
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagaaatttcagttattggagttccaatggatttaggacagatgcgtcgtggg
gttgatatgggaccgagcgcaatccgttatgcaggtgtaattgaaagaattgaagaaatt
ggatatgacgttaaagatatgggagatatatgtatagagagagaaaaagaagtagatgta
aatacaagcttaagaaaccttacacaagttgcaactgtatgtaacgaattagcaagtaag
gtggatcatattatagaagaaggacgttttccacttgtattaggtggcgatcatagtatc
gctattggtacattagctggtgttgcgaaacattataaaaacctaggtgttatttggtat
gatgcacatggcgatttaaatacagaagaaacttcaccatctggaaatattcacggtatg
tcacttgcagcaagtttagggtatggacatccggcgcttgtagatttatacggggcatat
ccaaaggtgaaaaaagagaatgttgtaattatcggtgcacgtgcattagatgaaggagaa
aaagactttattcgaaatgaaggtattaaagtattttcaatgcacgagattgatcgtatg
ggtatgacggctgttatggaagaaacaatcgcgtatttatctcatactgatggtgtgcat
ttatcattagatttagatggtcttgatcctcatgatgcaccaggagttggaacacctgta
attggtggcttatcttatcgtgaaagtcatttagcaatggagatgttagcggaagctgat
attgttacatctgccgagtttgttgaggtaaatacgattttagatgagcgaaatagaacg
gcaacaacagcggttgctttaatgggttctttattcggtgaaaaactaaaataa

DBGET integrated database retrieval system