KEGG   Bacillus cereus ATCC 10987: BCE_0198Help
Entry
BCE_0198          CDS       T00162                                 

Definition
(GenBank) alcohol dehydrogenase, zinc-containing
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
bca  Bacillus cereus ATCC 10987
Pathway
bca00010  Glycolysis / Gluconeogenesis
bca00071  Fatty acid degradation
bca00350  Tyrosine metabolism
bca00625  Chloroalkane and chloroalkene degradation
bca00626  Naphthalene degradation
bca01100  Metabolic pathways
bca01110  Biosynthesis of secondary metabolites
bca01120  Microbial metabolism in diverse environments
bca01130  Biosynthesis of antibiotics
bca01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bca00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCE_0198
  Lipid metabolism
   00071 Fatty acid degradation
    BCE_0198
  Amino acid metabolism
   00350 Tyrosine metabolism
    BCE_0198
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BCE_0198
   00626 Naphthalene degradation
    BCE_0198
Enzymes [BR:bca01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BCE_0198
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N_2 ADH_zinc_N ADH_N AlaDh_PNT_C THF_DHG_CYH_C Semialdhyde_dh ComJ DXP_reductoisom NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: AAS39134
UniProt: Q73F09
Position
complement(205564..206472)
Genome map
AA seq 302 aa AA seqDB search
MKAIICTQYGPPNVLQLQNIEKPTPKKNEVLVKIHATSVSTGDCRIRGFNSPLLFWIPMR
IILGFRKPRKPILGVELSGEIEEIGTAVTQFKKGDQIFALTELNLGGYAEYTCVHESGLI
ALKPTNMTYEEAAVIPFGGTSALHFLRKGRIKKGQQVLIYGASGSVGTAAVQLAKYFGTT
VTAVCSNSNFELVQSLGADKVIDYTKEDFTKGCERYDIIFDAVGKYKKSLCTNTLTPNGK
YVSVNGMMAKVSKEDMILLKKLTETEHLKPVIDRTYRLEEIAEAHMYVEKGHKKGNVSIT
LK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcaatcatttgcacacagtatggaccacctaacgttcttcagcttcaaaatata
gagaaacctacccctaaaaagaatgaagtattagttaaaattcacgcaacaagtgtatcg
actggagattgtagaatacgcggatttaatagccctctattattttggattcctatgcgg
atcatattaggttttagaaaaccgagaaagcctatactcggtgtagagttatccggcgaa
atcgaagaaataggaacagctgtaactcaatttaaaaaaggagatcaaatttttgcatta
acagaactaaacctcggcggttatgccgagtacacatgcgtacatgaaagtggattaata
gcattaaaacctaccaatatgacatatgaagaagcagcagttattccttttggtggaact
tcagcattgcatttcctgagaaagggccgtataaaaaaagggcaacaagtactcatatat
ggtgcctcaggatcggtaggaacagctgctgtacaacttgctaaatatttcggtacgacc
gttacggctgtttgtagtaattcaaattttgaactcgttcaatctttaggagctgataaa
gtaattgattatacgaaagaagattttactaaggggtgcgagcgctacgatattatattt
gatgcagttgggaagtataaaaaatccctttgtacaaatacattaacacccaatggaaaa
tatgtatctgttaatggaatgatggcaaaagtaagtaaagaggatatgattctactaaaa
aaactaactgaaacagaacatttaaaacctgttattgatagaacttaccgattagaagaa
attgctgaagctcatatgtatgtggaaaagggacataagaaaggtaacgtttcgattacc
ttaaaataa

DBGET integrated database retrieval system