KEGG   Bacillus cereus ATCC 10987: BCE_0742Help
Entry
BCE_0742          CDS       T00162                                 

Definition
alcohol dehydrogenase, zinc-containing (EC:1.1.1.1)
Orthology
K00004  
(R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bca  Bacillus cereus ATCC 10987
Pathway
Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bca00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    BCE_0742
Enzymes [BR:bca01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     BCE_0742
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     BCE_0742
    1.1.1.-  
     BCE_0742
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
767184..768236
Genome map
AA seq 350 aa AA seqDB search
MKALLWHNQRDVRVEEVPEPTVKPGAVKIKVKWCGICGTDLHEYLAGPIFIPKEEHPLTH
VKAPVILGHEFSGEVVEIGEGVTSHKVGDRVVVEPIYSCGKCEACKHGHYNVCEQLVFHG
LGGEGGGFSEYTVVPEDMVHHIPDEMTYEQGALVEPAAVAVHAVRQSKLKEGEAVAVFGC
GPIGLLVIQAAKAAGATPVIAVELSKERQELAKLAGADYVLNPATQDVLAEIRNLTNGLG
VNVSFEVTGVEVVLRQAIESTSFEGQTVIVSVWEKDATITPNNLVLKEKEVVGILGYRHI
FPAVIKLISSGQIQAEKLITKKITVDQVVEEGFEALVKDKTQVKILVSPK
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattactttggcataatcaacgtgatgtaagagtagaagaagtaccagaacca
actgtaaaaccaggagcagttaagattaaagtgaaatggtgtggtatctgcgggacagac
ctgcatgaatatttagcaggacctatttttattccaaaagaagagcatccattaacacat
gtaaaagcaccggttattttaggtcatgagtttagcggtgaggtagttgaaatcggtgaa
ggcgttacatctcataaagtgggagaccgcgtcgttgtagaaccaatttattcttgtggt
aaatgtgaagcttgtaaacatggacattacaatgtttgtgaacaacttgttttccacggt
cttggcggagaaggcggcggtttctctgaatatacagtagtaccagaagatatggttcac
catattccagatgaaatgacgtatgaacaaggtgcacttgtagaaccagcagctgtagca
gttcatgcagtacgtcaaagtaaattaaaagaaggggaagctgtagcagtatttggttgt
ggtccaattggacttcttgttatccaagcagctaaagcagcaggagcaactcctgttatt
gcagtcgagctttctaaagaacgtcaagagttagcaaaattagcaggtgcggattacgta
ttaaatccagctactcaagatgtattagcagaaattcgtaacttaacaaatggtttaggt
gtaaatgtgagctttgaagtaacaggtgttgaagtagtacttcgtcaagcaattgaaagt
acaagtttcgaaggacaaactgtaattgttagtgtatgggaaaaagacgcaacaattact
ccaaacaatcttgtactaaaagaaaaagaagtggttggtattttaggataccgtcatatc
ttcccagctgttattaaattaattagctctggccaaattcaagcagagaaattaattacg
aaaaaaatcacagtggatcaagttgttgaagaaggatttgaagcacttgtaaaagataaa
acacaagtgaaaattcttgtttcacctaaataa

DBGET integrated database retrieval system