KEGG   Bacillus cereus ATCC 10987: BCE_0742Help
Entry
BCE_0742          CDS       T00162                                 

Definition
alcohol dehydrogenase, zinc-containing (EC:1.1.1.1)
Orthology
K00004  
(R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bca  Bacillus cereus ATCC 10987
Pathway
Butanoate metabolism
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:bca00650]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
767184..768236
Genome map
AA seq 350 aa AA seqDB search
MKALLWHNQRDVRVEEVPEPTVKPGAVKIKVKWCGICGTDLHEYLAGPIFIPKEEHPLTH
VKAPVILGHEFSGEVVEIGEGVTSHKVGDRVVVEPIYSCGKCEACKHGHYNVCEQLVFHG
LGGEGGGFSEYTVVPEDMVHHIPDEMTYEQGALVEPAAVAVHAVRQSKLKEGEAVAVFGC
GPIGLLVIQAAKAAGATPVIAVELSKERQELAKLAGADYVLNPATQDVLAEIRNLTNGLG
VNVSFEVTGVEVVLRQAIESTSFEGQTVIVSVWEKDATITPNNLVLKEKEVVGILGYRHI
FPAVIKLISSGQIQAEKLITKKITVDQVVEEGFEALVKDKTQVKILVSPK
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattactttggcataatcaacgtgatgtaagagtagaagaagtaccagaacca
actgtaaaaccaggagcagttaagattaaagtgaaatggtgtggtatctgcgggacagac
ctgcatgaatatttagcaggacctatttttattccaaaagaagagcatccattaacacat
gtaaaagcaccggttattttaggtcatgagtttagcggtgaggtagttgaaatcggtgaa
ggcgttacatctcataaagtgggagaccgcgtcgttgtagaaccaatttattcttgtggt
aaatgtgaagcttgtaaacatggacattacaatgtttgtgaacaacttgttttccacggt
cttggcggagaaggcggcggtttctctgaatatacagtagtaccagaagatatggttcac
catattccagatgaaatgacgtatgaacaaggtgcacttgtagaaccagcagctgtagca
gttcatgcagtacgtcaaagtaaattaaaagaaggggaagctgtagcagtatttggttgt
ggtccaattggacttcttgttatccaagcagctaaagcagcaggagcaactcctgttatt
gcagtcgagctttctaaagaacgtcaagagttagcaaaattagcaggtgcggattacgta
ttaaatccagctactcaagatgtattagcagaaattcgtaacttaacaaatggtttaggt
gtaaatgtgagctttgaagtaacaggtgttgaagtagtacttcgtcaagcaattgaaagt
acaagtttcgaaggacaaactgtaattgttagtgtatgggaaaaagacgcaacaattact
ccaaacaatcttgtactaaaagaaaaagaagtggttggtattttaggataccgtcatatc
ttcccagctgttattaaattaattagctctggccaaattcaagcagagaaattaattacg
aaaaaaatcacagtggatcaagttgttgaagaaggatttgaagcacttgtaaaagataaa
acacaagtgaaaattcttgtttcacctaaataa

DBGET integrated database retrieval system