KEGG   Bacillus cereus ATCC 10987: BCE_1019Help
Entry
BCE_1019          CDS       T00162                                 

Definition
type III restriction-modification system enzyme, R subunit
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
bca  Bacillus cereus ATCC 10987
Brite
Enzymes [BR:bca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     BCE_1019
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1049124..1052087
Genome map
AA seq 987 aa AA seqDB search
MKILLEELPHQEESLKAILENFTGIDNAANDSDVDYVYANPLIRGRYNEISNIDVKMETG
TGKTYVYTRLMYEMHQQYGIFKFVIVVPSPAIKEGAKNFIQSDYAKQHFSQFYENVRIEL
NVINAGDFKSKSGRRNFPAQLLNFVEGSRQNSNTIEVLLINADMLRSKSMRNNDYDQTLI
GGTTSPIEAIQDTRPVVIIDEPHRFPRDKANYQSIEAIKPQVIIRFGATFPEVTTGKGSN
KITKKDYYRKKPQFDLNAIESFNNGLVKGIDIYYPNLTEEQAKNRYVVDSVKAKELVLKQ
NSKSWILHVGDNLAEVDSGFEGDIEYAGSKMLSNELELEKGMTLIPGTYRSTYQELIIKD
AIDKHFEIEQANFLRANQRENNVPRIKTLSLFFIDSITSYRQDDGWLKATFERLLKEKLS
RLVAEYEFKRLPREKEYLEFLRATQSSLASDNQNVHAGYFGEDRGSGDESIQAEVDDILK
NKEKLLSFKDENGNWQTRRFLFSKWTLREGWDNPNVFVIAKLRTSGSDNSKIQEVGRGLR
LPVDETGHRIQQDEWPTRLAFLIGYDEKDFAQKLIGEINSDAKLQLNEEKLTEDMIQLIV
TKRKKVNPEFTDERLLEHLDNLGIINRKNEFKESIDIGGVQKSGFEWLVELYPELNTNRL
REGKVIDTKKHSIKVRVKLRKENWEKVKELWQQFSNRYMLEFQRIPETISFMAEQIVGNH
SLYEREVPMQMKESLHASDDNESVVLREQENEYQRIYLPGMAYGKFVKRINIATGIPIKE
IHANLFKLMKSSLKGDARYLSELSLNNIIREFKKRFDEIFAQAYEYKKLDFQARTAIYNP
EMDSFVDDINAEVIGVNIDEQAQEDNRYLYELPPMRYDSVTPERDLLRHGYNDKVTVFGK
LPRRAIQVPKYTGGSTTPDFIYMIEKDNDSSVYVLVETKAENMRLEDQRIIDIQKKFFDT
LKEHHIEFIEATSAQQVYSIIRKLSEE
NT seq 2964 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatattattagaagaactgcctcaccaagaagagagtttgaaagctattttggaa
aatttcacaggaatagataatgctgccaacgattctgatgtggattatgtatatgctaat
ccattaattcgtggcagatataatgaaatctctaatatcgatgtgaaaatggagactggt
acaggaaaaacttatgtctatacaagattaatgtacgaaatgcatcaacagtatggtatt
ttcaagtttgtgattgtagttccgagtcctgcgattaaagaaggagctaaaaacttcata
caaagtgattatgcgaagcagcatttctctcaattttatgaaaacgtaagaatcgaatta
aatgtaattaatgcgggtgattttaaatctaaatctggacgcagaaatttcccggctcaa
ttacttaattttgttgaaggaagtagacaaaattctaatactattgaagtattattaatt
aatgctgatatgttacgttcaaaaagcatgcgtaataacgattatgatcagacattaatt
ggagggacgacaagtccaatagaggctatacaagatacacgtccagtagtcattattgat
gaaccgcatcgtttcccaagagataaggctaattatcaatcaattgaagctattaaaccc
caagtgattatccgtttcggagcaacatttccagaagttactacgggcaaaggtagtaat
aaaattactaagaaagattattatcgaaaaaaaccacaatttgatttgaatgcaattgag
agctttaataatggtttggtaaaagggattgatatctattatccaaatctaacagaagaa
caagcaaaaaaccgttatgtagtagatagtgtgaaggcaaaggaactggtacttaagcaa
aatagtaagagctggatacttcatgttggtgataatttagcagaagtagattcaggtttt
gaaggtgatattgaatatgctggttcaaagatgttaagtaatgaattagagcttgaaaaa
ggtatgaccttgattccaggtacttatcgctcaacttatcaggagttgattattaaagat
gcaattgataagcactttgaaattgaacaagctaattttttaagagcgaatcaaagggaa
aataatgtaccaagaattaaaacattaagtctctttttcattgatagtattactagttat
cgtcaggatgatgggtggctaaaagcaacttttgaacgtttattaaaagaaaagctttct
cgcttagtagcggaatatgaattcaaacgtctacctagagaaaaagagtatttagaattt
ctaagggctacccaatcaagtttagccagtgacaatcaaaatgtacatgcaggatatttt
ggggaagatcggggttctggtgatgaatcgattcaagcagaagttgacgatattttgaaa
aataaagaaaagcttttaagttttaaagatgaaaatggtaattggcaaacgagacgtttt
ttattttcaaaatggacgttacgtgaaggatgggataacccaaatgtttttgttattgct
aaattgcgtacttctggtagtgacaacagtaaaattcaagaagttggccgaggattacga
ttaccagtggatgaaacgggtcatagaattcaacaagatgagtggccgactagactagca
tttttaattggttatgatgaaaaagattttgcacaaaaactcattggtgagatcaatagt
gatgcgaagcttcaattaaacgaagaaaaattaacggaagatatgattcaattaatagtc
accaaacgaaaaaaagtaaatccagaatttacggacgaaagattactggagcatttagat
aatttgggtattattaataggaaaaatgagtttaaagaatctattgatattggaggcgtt
caaaaaagtggatttgaatggttagttgaactataccctgaattgaatacgaatcgccta
cgagaaggaaaggttatagatacaaaaaaacattcaataaaagttcgtgtaaaattaaga
aaagaaaattgggaaaaggtgaaagagttgtggcaacaattttccaatcgttatatgttg
gaatttcaacgtatcccagaaacaattagttttatggctgaacaaatagtgggtaaccac
agtttatatgaacgtgaagttcctatgcaaatgaaggaatcgctgcatgcaagtgatgac
aacgagagtgttgttttgcgagaacaagaaaatgaatatcaacgtatatacttgccgggt
atggcttacggaaagtttgttaaaagaattaatatagcaacaggtatacctatcaaagag
atccatgcaaacttattcaaactcatgaagtcatctttaaaaggtgatgctagatactta
agtgaattatctcttaataatattatccgagaatttaaaaagcggtttgatgaaatattt
gcacaagcttatgaatataaaaagttagattttcaagcgcgtacagcaatttataatcct
gaaatggatagttttgtggatgatatcaatgcagaagttattggagtaaatattgatgaa
caagcgcaagaagataatcgctatctctatgaacttcctccaatgaggtatgacagtgta
acacctgaaagagacttgttacgccatggatataatgataaggtaactgtttttggaaag
ctacctagacgggccattcaggttccaaaatatactgggggctcaacaacgccagacttt
atatatatgattgaaaaagataatgattcaagtgtgtatgtacttgttgaaactaaagct
gagaatatgaggttggaagatcaaagaattattgatattcaaaagaaattctttgataca
ttgaaagaacatcatattgaattcatagaggcaacaagtgcgcaacaagtatattctata
attagaaagttgtctgaagagtga

DBGET integrated database retrieval system