KEGG   Bacillus cereus ATCC 10987: BCE_1125Help
Entry
BCE_1125          CDS       T00162                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bca  Bacillus cereus ATCC 10987
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:bca00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1131150..1132682
Genome map
AA seq 510 aa AA seqDB search
MKKYILSLDQGTTSSRAILXNKKGEIVHSAQKEFTQHFPKPGWVEHNAQEIWGSILAVIA
TCLSEADVKPEQIAGIGITNQRETAVVWDKTTGKPIYNAIVWQSRQTAEICDELKEKGYG
EMVREKTGLLIDAYFSGTKVKWILDNVEGAREKAENGDLLFGTIDTWLVWKLSGGKAHVT
DYSNASRTLMFNIHDLQWDDELLDMLTVPKSMLPEVRPSSEVYGETIDYHFFGQNVPIAG
VAGDQQAALFGQACFGEGMAKNTYGTGCFMLMNTGEKAVASEHGLLTTIAWGIDGKVNYA
LEGSIFVAGSAIQWLRDGMRMFKDASESEVYANRVESTDGVYVVPAFVGLGTPYWDSEVR
GAMFGVTRGTTKEHFIRATLESLAYQXKDVLCAMEADSGIELKTLRVDGGAVKNNFLMKF
QSDILDVPVERPVINETTALGAAYLAGLAVGYWKNQDEIKEQWHMDKRLNQQWKRKQAKS
YMLDGKKQLKQQKLSNNHKQCYNGDKLIIR
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatatattctttcattagaccaaggaacaactagctcacgtgcaattctgktc
aataaaaagggtgaaattgttcattcagctcaaaaagaatttacacaacattttccaaag
ccaggctgggtagagcataacgcgcaagaaatttggggatctattttagcagttatcgca
acttgcttaagcgaagcagatgtaaaaccagaacaaatcgctggtatcggtattacgaac
caacgtgaaacagcggttgtatgggataaaacaacaggcaaaccaatttataacgcaatc
gtatggcaatctcgccaaacagctgaaatttgtgatgagttaaaagaaaaaggttatggc
gaaatggttcgcgaaaaaacaggtcttttaattgacgcatatttctctggtacgaaagta
aaatggattttagataacgttgaaggtgcaagagagaaagcggaaaacggcgatctatta
ttcggaacaattgatacatggcttgtatggaaactatctggtggtaaagcgcacgtaacg
gattactcaaatgcatcacgtacgttaatgtttaacattcacgacttacaatgggatgat
gaacttctagacatgttaacagtaccaaagagcatgcttccagaagtacgtccatcatct
gaagtgtatggagaaacaattgactatcacttcttcggtcaaaatgtaccgattgccggt
gtagctggtgaccaacaagcagcattatttggacaagcttgtttcggtgaaggtatggcg
aaaaatacttacggaactggttgcttcatgttaatgaacactggtgaaaaagcagtagct
tctgagcatggtctattaacaacaattgcatgggggatagatggtaaagtaaactacgca
ttagaaggaagtattttcgtagcaggttctgcaattcaatggttacgtgacggaatgcgc
atgtttaaagatgcaagtgagagtgaagtatatgcgaatcgcgttgaatcaactgacggt
gtatacgttgtaccagcattcgtaggattaggtacaccgtactgggatagtgaagtacgc
ggtgctatgtttggtgtaacacgcggtacgacgaaagagcatttcattcgtgcaacacta
gaatctttagcttaccaamcgaaagacgtattatgcgcaatggaagcagattcaggtatt
gaactgaaaacattacgcgttgatggcggagcagttaaaaataacttcttaatgaagttc
caaagtgatattttagatgttcctgtagagcggccggtgatcaatgaaacaacagcttta
ggtgcagcgtacttagctggtcttgcggttggatattggaaaaaccaagatgaaattaaa
gaacagtggcatatggacaaacgcttgaaccaacaatggaagcggaaacaagcaaagagc
tatatgctggatggaaaaaagcaattgaagcaacaaaagctttcaaataatcataaacag
tgttataatggtgacaagttaataattcggtag

DBGET integrated database retrieval system