KEGG   Bacillus cereus ATCC 10987: BCE_1228Help
Entry
BCE_1228          CDS       T00162                                 

Gene name
aceB
Definition
(RefSeq) malate synthase A (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
bca  Bacillus cereus ATCC 10987
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCE_1228 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BCE_1228 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    BCE_1228 (aceB)
Enzymes [BR:bca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BCE_1228 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1238426..1240015
Genome map
AA seq 529 aa AA seqDB search
MSTQTSRVTLVGEMLPAYNEILTPEALSFLKELHENFNERRIELLQKRAEKQKRIDAGEF
PKFLEETKHIREADWTIAKLPKDLEDRRVEITGPVDRKMVINALNSGAHLFMADFEDSNS
PTWENAIEGQINLRDAVKGTISHKNENGKEYRLNSKTAVLIVRPRGWHLEEKHMQVDGKN
MSGSLVDFGLYFFHNAKALLAKGSGPYFYLPKMESYLEARLWNDVFVFAQKYIGIPNGTI
KATVLLETIHASFEMDEILYELKDHSAGLNCGRWDYIFSFLKGFRNHNEFLLPDRAQVTM
TAPFMRAYSLKVIQTCHRRNAPAIGGMAAQIPIKNNPEANEAAFEKVRADKEREALDGHD
GTWVAHPGLVPVAMEVFNHIMKTPNQIFRKREEIHVTEKDLLEVPVGTITEEGLRLNISV
GIQYIASWLSGRGAAPIYNLMEDAATAEISRAQVWQWIRHEGGKLNDGRNITLELMEELK
EEELAKIEREIGKEAFKKGRFQEATTLFTNLVRNDEFVPFLTLPGYEIL
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacgcaaacttcacgggttacactcgtgggagaaatgttaccagcgtacaacgaa
atattgacacctgaggcgcttagttttttaaaggaactacatgaaaatttcaatgagcgc
cgcatagaacttttacaaaagcgtgcggagaaacaaaagagaattgatgcaggagagttt
ccgaagtttttagaagaaacgaagcacatacgtgaagcggattggacaattgctaaattg
ccaaaagatttagaggatcgccgcgtagagattactggcccagtagatagaaagatggtt
attaacgctttaaattcaggagcacatctttttatggcggattttgaagattcgaattca
ccaacttgggaaaatgcaattgaaggtcaaataaacttacgagatgcagtaaagggaacg
atttcacataaaaatgaaaacggaaaagaatatcgtttaaatagtaaaacagcagtatta
attgtgcgtccaagaggatggcatttagaagaaaaacatatgcaagttgacgggaagaat
atgtctggtagcttagtagattttggactttattttttccataatgcgaaagctctttta
gcaaaaggaagcggtccatacttttacttaccgaaaatggaaagctatttagaagcaagg
ctatggaatgatgttttcgtatttgctcaaaaatatatcggtattccaaacggaacgatt
aaagcaacagtattattggaaacgattcacgcttcgtttgaaatggatgaaattttgtat
gagcttaaagatcattctgctggattaaattgcggaagatgggattatatttttagtttt
ttaaagggtttccgtaatcataatgaatttttacttccagatagagcgcaagtcacgatg
acggcgccgtttatgcgcgcgtattctttgaaagtcattcaaacgtgtcaccgtcgtaat
gcaccagctattggaggaatggcagcacaaattccaattaaaaacaatccagaagcgaat
gaagcagcttttgaaaaagtgcgtgcggataaggagcgcgaagctttagacggtcatgat
gggacttgggttgcccacccgggacttgtaccagtcgcgatggaagtatttaatcacatt
atgaaaacgccgaatcaaatttttagaaaacgtgaagaaatacatgttacagaaaaggat
ttattagaagtaccagtgggaacgattacagaagagggtcttcgtctgaatattagcgta
ggtattcaatatattgcatcttggttaagcggccggggagcagcaccaatttataactta
atggaagatgcagcaacagcagaaatttctagggcacaagtatggcaatggattcgccat
gaaggtggaaaattaaatgatggccgtaatattacacttgaattaatggaagagctaaaa
gaagaagagttagcaaaaatagaaagagagattggtaaagaagcctttaagaaagggaga
ttccaagaggcgacaacgttatttacaaatctcgttcggaatgatgaatttgtaccattt
ttaacattaccgggttatgaaattttataa

DBGET integrated database retrieval system