KEGG   Bacillus cereus ATCC 10987: BCE_1229Help
Entry
BCE_1229          CDS       T00162                                 

Gene name
aceA
Definition
(RefSeq) isocitrate lyase (EC:4.1.3.1)
  KO
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
bca  Bacillus cereus ATCC 10987
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCE_1229 (aceA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BCE_1229 (aceA)
Enzymes [BR:bca01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     BCE_1229 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1240039..1241316
Genome map
AA seq 425 aa AA seqDB search
MKNERIEKLQESWELDTRWKGITRPYSAEDVIRLRGSIDIEHTLARRGAEKLWASLHTED
YINALGALTGNQAMQQVKAGLKAIYLSGWQVAADANLSGHMYPDQSLYPANSVPAVVKRI
NQTLQRADQIQHMEGSGDTDYFVPIVADAEAGFGGQLNVFELMKGMIEAGASGVHFEDQL
SSEKKCGHLGGKVLLPTQTAVRNLISARLAADVMGVPTIIVARTDADAADLITSDIDPVD
KAFITGERTPEGFYRTKAGLDQAIARGLAYAPYADLVWCETSEPNLEDAKRFAEAIHKEH
PGKLLAYNCSPSFNWKQKLDEKTIASFQKEIASYGYKFQFVTLAGFHSLNYGMFELARGY
KERGMAAYSELQQAEFAAEKHGYSATRHQREVGTGYFDEVAQVITGGTSSTTALKGSTEE
AQFTK
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgaaagaatcgagaaattacaagagagctgggaactagatacgcgttggaaa
gggatcacacgtccatattcggcagaagatgtaattcgcctgcgtggatcaattgatatt
gagcatacattagcgcgccgcggtgctgaaaagctttgggcgtcgcttcatacggaagat
tatattaacgcacttggcgcattaacaggaaaccaagcgatgcaacaagtaaaagctggg
ttaaaagcaatttatttaagtggatggcaagtagcggcggatgcgaacctttctggacat
atgtatccagaccaaagtttatatccagcgaacagcgtacctgctgtagtaaaacgaatt
aatcaaacactgcaacgtgcggatcaaattcagcatatggaaggaagcggtgatacagat
tatttcgtgccaattgtagcagatgcagaagctggatttggcggacaattaaacgtattt
gagctgatgaaaggtatgattgaagcaggcgcatcaggtgtgcacttcgaagatcaatta
tcttcagagaaaaaatgcggtcatttaggcggaaaagtattactaccgacgcaaacagcg
gtgcgtaatttaatttcggcacgcctggcggcagacgtaatgggagtgccgacaattatc
gttgcaagaacagatgcggatgcagcagatttaattacgagcgatatcgatcctgttgat
aaagcgtttattaccggagaaagaacaccagaaggattttatcgtacgaaggcgggcctt
gatcaagcaattgcacgtggtttagcatacgctccttatgcagaccttgtttggtgcgag
acgtctgaaccaaatttagaagatgcaaaacgatttgcggaagcaattcataaagaacat
ccagggaaattgcttgcatacaactgttcaccttcatttaactggaaacaaaaactagat
gagaaaacaattgcgagcttccaaaaagaaatcgcatcttacggttataagttccagttc
gtaacacttgctggattccactcattaaactacggcatgttcgaattagcacgcggctat
aaagagcgcggcatggcagcgtactctgaactacaacaagcggaattcgcagcagaaaaa
cacggctactctgcaactcgccatcaacgagaagtaggaacaggttactttgatgaagta
gcacaggtgattacaggcggtacttcatcaacgacagcattaaaaggatctacagaagaa
gcacaatttacgaaataa

DBGET integrated database retrieval system