KEGG   Bacillus cereus ATCC 10987: BCE_1259Help
Entry
BCE_1259          CDS       T00162                                 

Gene name
asnO
Definition
asparagine synthetase, glutamine-hydrolyzing (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bca  Bacillus cereus ATCC 10987
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bca00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1265360..1267207
Genome map
AA seq 615 aa AA seqDB search
MCGITGWVDYKRSLEGERDVVTKMAETLAKRGPDDNKVWIKGNVAFGHKRLIVVDPEGGK
QPMTCLKGETNYAICYNGELYNTEDIRKELLRRGYTFKGHSDTEVLLASYMEWKEECVDH
LNGIYAFAVWDEQKEQVFIARDRLGVKPLFYKYDSGRLLFGSELKAILAHPDVKAEVTLE
GLSEIFGLGPSRTPGHGIYAGIKELRPGHAMTFSKNGLCIWRYWNVESKKHEDSFEETVE
KTRFLLQDAITRQLVSDVPLCTFLSGGVDSSAITAIAAKEYERSGKGQLHTYSIDYEDND
KYFKANAFQPNSDAPFIHLMTETFQTIHHRCVISNEQLAQYLTEAVLVRDLPGMADIDSS
LLWFCREIKQDFVVGLSGECADEIFGGYPWFYREDDLQSSAFPWMRSTEAREQLLKKEWR
NKLNLQQYVQRRYEESIQEVPILEGESPIEAKRRQLFYLNMVWFMTTLLDRKDRMSMGAS
LEVRVPFADHRLVEYAWNIPWEMKMYKNREKGLLRKALEGLLPNDILYRKKSPYPKTHNP
HYTKAVTVWLQDLLTDKGSILHELFDKEQLSGLIESGGSAFQTPWFGQLMTGPQLLAHLA
QIHVWFKEYGVNIKE
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgggattacaggatgggtggattataaacgctcattagaaggagaacgggacgtc
gttacgaagatggctgagacgttagcgaagcgtggcccagatgataataaagtttggatt
aaaggaaatgttgcatttggacataaacggttaatcgttgttgatcctgaaggtgggaaa
caaccgatgacttgtttaaaaggtgaaacgaattatgcaatttgctataacggtgaactg
tataatacggaagatattcgaaaggaactattaagaaggggatatacgttcaaaggtcat
tctgatacggaagtactattagcgtcgtatatggaatggaaagaagaatgtgtcgatcat
ttaaacggtatatatgcgtttgccgtatgggatgaacagaaagaacaagtgtttatcgcg
cgtgatcgattaggtgtaaaaccactattttataaatatgatagtgggcgattactattt
ggttcagagttaaaagcgatattggcgcacccagatgtgaaggcggaagtgacgttagaa
ggattatccgaaatattcggccttggaccatctagaacgcctggtcacggtatatatgct
ggtataaaagaattacgtccaggtcatgcgatgacattttcaaagaacggtttatgtata
tggagatattggaatgtagaaagtaaaaagcacgaagactcctttgaagaaacagtagag
aaaacacgctttttattacaagatgcgattacaaggcagctcgtttctgatgtaccactg
tgcacttttctatctggtggtgtagattcgagtgcgattacagcaattgctgcgaaagaa
tacgaaagatcaggaaaagggcaattacacacatattcaattgattatgaagataatgac
aaatattttaaagcgaatgcattccagccaaattcagatgcaccatttattcatttgatg
acggagacgtttcaaacgattcatcatcgatgcgtcatttcaaatgaacaattggcgcag
tatttaacagaagctgtactcgttcgtgatttgcctggtatggcagatattgattcgtca
ttattatggttttgtcgtgaaattaaacaagattttgtcgtcggtttatctggggaatgt
gcagatgaaatatttggtggttatccgtggttttatagagaagatgatttacaatcgagt
gcatttccgtggatgcgttctacagaagcacgtgaacaattgctaaagaaagaatggaga
aataaattaaatttacaacaatatgtacaaaggcgctatgaagagtccattcaagaagtt
cctattttagagggagaaagcccaattgaagcaaagagaagacaattattttatttaaat
atggtatggtttatgacaacattattagacagaaaagaccgtatgagtatgggcgcaagc
ttagaagtacgcgttccatttgcggatcaccgacttgtcgaatatgcgtggaatattcct
tgggaaatgaaaatgtataaaaatcgcgaaaaaggtctattgcgtaaagcactagaagga
ttacttccaaatgacatcttatatagaaagaagagcccgtatccgaaaacgcataatccg
cactatacgaaagcagtaacggtgtggctacaagatttattaacggataaaggctcgatt
ttacacgaactatttgataaagaacagctgagcggattaattgagtcaggcggcagcgca
tttcaaacaccttggttcggtcaattaatgactgggcctcagcttttagctcatttagcg
caaattcatgtttggtttaaagaatacggggtaaatattaaagaatag

DBGET integrated database retrieval system