KEGG   Bacillus cereus ATCC 10987: BCE_1335Help
Entry
BCE_1335          CDS       T00162                                 

Definition
glucose-1-phosphate thymidylyltransferase, putative
Orthology
K00973  
glucose-1-phosphate thymidylyltransferase [EC:2.7.7.24]
Organism
bca  Bacillus cereus ATCC 10987
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bca00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    BCE_1335
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BCE_1335
Enzymes [BR:bca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.24  glucose-1-phosphate thymidylyltransferase
     BCE_1335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1344089..1344826
Genome map
AA seq 245 aa AA seqDB search
MKGIILAGGTGSRLYPITKVTNKHLLPVGRYPMIYHAVYKLKQCEITDIMIITGKEHMGD
VVSFLGSGQEFGVSFTYRVQDKAGGIAQALGLCEDFVGNDRMVVILGDNIFSDDIRPYVE
EFANQKEGAKVLLQSVDDPERFGVAHIQNDKIIEIEEKPKEPKSSYAVTGIYLYDSKVFS
YIKELKPSARGELEITDINNWYLKRGVLTYNEMSGWWTDAGTHISLQRANTLARDINFGK
QFNGE
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggaattattttagcaggtggaactggatcaagattatatccaataacgaaagta
acgaataaacatttgcttccagttggacggtatccaatgatttatcatgcagtatataag
ctaaaacaatgcgaaattacagatattatgattattacaggtaaagagcatatgggagat
gttgttagttttttaggaagcggtcaagaatttggcgtgtcctttacgtatcgtgtgcaa
gataaggctggcggaattgcgcaagcattagggctttgtgaagacttcgttgggaatgat
cgcatggtagttatattaggagataatatcttttctgatgatattcgtccgtatgttgaa
gagtttgcaaatcaaaaagagggtgcgaaagtactgctgcaatctgtagatgatccggag
agatttggcgtagcgcatattcaaaacgacaaaataattgaaattgaagaaaagccgaaa
gagccgaaaagttcctatgcagtcacaggaatttatttgtatgattcgaaagtcttttct
tatataaaagaattaaaaccttccgcaaggggagaacttgaaattacagatattaataat
tggtatttaaaacgaggggtacttacttataatgaaatgagcggttggtggactgatgca
ggaactcacatttctcttcaaagggcgaatacgttagcgcgggatataaactttggtaaa
cagtttaacggagaatag

DBGET integrated database retrieval system