KEGG   Bacillus cereus ATCC 10987: BCE_1335Help
Entry
BCE_1335          CDS       T00162                                 

Definition
glucose-1-phosphate thymidylyltransferase, putative
Orthology
K00973  
glucose-1-phosphate thymidylyltransferase [EC:2.7.7.24]
Organism
bca  Bacillus cereus ATCC 10987
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:bca00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:bca00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1344089..1344826
Genome map
AA seq 245 aa AA seqDB search
MKGIILAGGTGSRLYPITKVTNKHLLPVGRYPMIYHAVYKLKQCEITDIMIITGKEHMGD
VVSFLGSGQEFGVSFTYRVQDKAGGIAQALGLCEDFVGNDRMVVILGDNIFSDDIRPYVE
EFANQKEGAKVLLQSVDDPERFGVAHIQNDKIIEIEEKPKEPKSSYAVTGIYLYDSKVFS
YIKELKPSARGELEITDINNWYLKRGVLTYNEMSGWWTDAGTHISLQRANTLARDINFGK
QFNGE
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggaattattttagcaggtggaactggatcaagattatatccaataacgaaagta
acgaataaacatttgcttccagttggacggtatccaatgatttatcatgcagtatataag
ctaaaacaatgcgaaattacagatattatgattattacaggtaaagagcatatgggagat
gttgttagttttttaggaagcggtcaagaatttggcgtgtcctttacgtatcgtgtgcaa
gataaggctggcggaattgcgcaagcattagggctttgtgaagacttcgttgggaatgat
cgcatggtagttatattaggagataatatcttttctgatgatattcgtccgtatgttgaa
gagtttgcaaatcaaaaagagggtgcgaaagtactgctgcaatctgtagatgatccggag
agatttggcgtagcgcatattcaaaacgacaaaataattgaaattgaagaaaagccgaaa
gagccgaaaagttcctatgcagtcacaggaatttatttgtatgattcgaaagtcttttct
tatataaaagaattaaaaccttccgcaaggggagaacttgaaattacagatattaataat
tggtatttaaaacgaggggtacttacttataatgaaatgagcggttggtggactgatgca
ggaactcacatttctcttcaaagggcgaatacgttagcgcgggatataaactttggtaaa
cagtttaacggagaatag

DBGET integrated database retrieval system