KEGG   Bacillus cereus ATCC 10987: BCE_1359Help
Entry
BCE_1359          CDS       T00162                                 

Definition
indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bca  Bacillus cereus ATCC 10987
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bca00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BCE_1359
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BCE_1359
Enzymes [BR:bca01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     BCE_1359
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1362940..1363701
Genome map
AA seq 253 aa AA seqDB search
MGTILDKIVEQKKKEVATLYETYTPIKESRKTHSLVESLQQFTVIAEVKRASPSKGDINL
HVDVRKQVKTYEECGAGAVSVLTDGQFFKGSFYDLQTAREESSIPLLCKDFIIDKIQIDR
AYEAGADIILLIVAALPKEKLKELYSYVLEKGLEAIVEIHDEEELEIAIELNPHVIGINN
RNLKTFEVDLGQTEKLGKRLNEEKLLWISESGIHSKEDIIRVKRAGAKGVLVGEALMTSS
SIRTFFEDCKVNI
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
gtggggacgattttagataaaattgtagaacagaagaaaaaggaagttgcgacattatat
gaaacatatacaccaataaaagaaagtagaaagacacattcactcgtagaatcattacag
cagtttactgttattgcagaagtaaagcgagcatcaccatcaaaaggagatatcaattta
cacgttgatgtaagaaaacaagtgaaaacatatgaagaatgcggcgcgggtgctgtttct
gttttaacagacggtcaattttttaaagggtcattttatgatttacaaacagcaagagaa
gaaagtagcattccgcttttatgtaaagatttcataattgataagattcaaattgataga
gcgtatgaggctggcgcagatattattttattaattgtagcagcgttaccgaaagagaag
ttaaaagagctgtatagctacgtactagaaaaagggttagaagcaattgttgaaattcat
gatgaagaggaattagaaattgcaatcgaattaaatccgcacgttatcggtattaacaac
cgtaatttaaaaacattcgaagtcgatttaggccaaacagaaaagcttggaaaacgatta
aatgaggagaaattactttggattagtgagagcggaattcattcaaaagaagatataatc
cgcgtcaagcgagctggagcaaaaggtgtattagttggagaggcacttatgacatcatct
tctattcgtaccttttttgaagattgtaaggtgaacatatga

DBGET integrated database retrieval system