KEGG   Bacillus cereus ATCC 10987: BCE_1361Help
Entry
BCE_1361          CDS       T00162                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bca  Bacillus cereus ATCC 10987
Pathway
bca00260  Glycine, serine and threonine metabolism
bca00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bca01100  Metabolic pathways
bca01110  Biosynthesis of secondary metabolites
bca01130  Biosynthesis of antibiotics
bca01230  Biosynthesis of amino acids
Module
bca_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bca00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCE_1361 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BCE_1361 (trpB)
Enzymes [BR:bca01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BCE_1361 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AAS40290
UniProt: Q73BQ7
Position
1364309..1365502
Genome map
AA seq 397 aa AA seqDB search
MNYAYPDEKGHYGIYGGRYVPETLMQSVLELEEAYKEAMEDEAFQKELNHYLKTYVGRET
PLYYAENMTKYCGGAKIYLKREDLNHTGAHKINNTIGQALLAVRMGKKKVVAETGAGQHG
VATATVCALLGLECVIFMGEEDVRRQKLNVFRMELLGAKVESVAAGSGTLKDAVNEALRY
WVSHVHDTHYIMGSVLGPHPFPQIVRDFQSVIGKETKKQYEALEGKLPEAVVACIGGGSN
AMGMFYPFVHDEEVALYGVEAAGKGVHTEQHAATLTKGSVGVLHGSMMYLLQNEEGQIQE
AHSISAGLDYPGVGPEHSLLKDIGRVSYHSITDDEALEAFQLLTKKEGIIPALESSHAVA
YALKLAAQMKKDEGLVICLSGRGDKDVESIKRYMEEV
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaattacgcatatccagatgaaaaaggtcactacggtatatacggaggacgatacgtt
ccagaaacgttaatgcaatctgtattagaactagaagaagcatataaagaggcgatggaa
gatgaagcatttcaaaaggaattaaatcattatttaaaaacgtacgtcggaagagaaaca
ccgctatattatgctgaaaatatgacgaagtattgcggcggtgcaaaaatttatttaaaa
cgtgaagatttgaaccatacaggagctcataaaattaacaatacaattggtcaggcactt
cttgcagtaagaatgggtaagaaaaaagttgtcgctgaaacaggggctggacaacacgga
gtcgcaacagctactgtatgtgcccttctcggattagaatgcgtcatttttatgggagaa
gaagatgtaagacgtcaaaaattaaatgtgttccgaatggaattactcggagcgaaagta
gaaagtgtggcggcaggtagcggtacattaaaagatgcggtaaacgaggcgcttcgttac
tgggtttcacatgtgcatgatacgcactacattatgggatctgttcttggaccacatcca
ttcccacaaattgtccgtgatttccaaagtgtaattgggaaagaaacgaaaaaacaatat
gaagcgttagaaggaaagttaccagaagctgttgttgcttgtattggtggtggtagtaat
gcgatgggaatgttttatccgttcgtgcatgatgaagaagttgctctttacggcgtagaa
gcagctggaaaaggagttcatacagaacagcatgcagctactttaacgaaaggaagcgtt
ggcgttctccacggatcgatgatgtaccttctgcaaaatgaagaaggacaaattcaagaa
gctcactctatttcagctggacttgattacccgggggttggtccagaacatagtttacta
aaagatattggccgcgtttcttatcattccattactgatgatgaagcgttagaagcgttt
caattattaacgaaaaaagaaggaattatcccggcgttagaaagctcgcatgctgtcgca
tatgcattaaaattagcggcgcaaatgaagaaagacgaagggcttgtcatttgtttatct
ggccgtggtgataaagatgtagagagtataaaacgttatatggaagaggtgtaa

DBGET integrated database retrieval system