KEGG   Bacillus cereus ATCC 10987: BCE_1361Help
Entry
BCE_1361          CDS       T00162                                 

Gene name
trpB
Definition
tryptophan synthase, beta subunit (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bca  Bacillus cereus ATCC 10987
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bca00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BCE_1361 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCE_1361 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BCE_1361 (trpB)
Enzymes [BR:bca01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BCE_1361 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1364309..1365502
Genome map
AA seq 397 aa AA seqDB search
MNYAYPDEKGHYGIYGGRYVPETLMQSVLELEEAYKEAMEDEAFQKELNHYLKTYVGRET
PLYYAENMTKYCGGAKIYLKREDLNHTGAHKINNTIGQALLAVRMGKKKVVAETGAGQHG
VATATVCALLGLECVIFMGEEDVRRQKLNVFRMELLGAKVESVAAGSGTLKDAVNEALRY
WVSHVHDTHYIMGSVLGPHPFPQIVRDFQSVIGKETKKQYEALEGKLPEAVVACIGGGSN
AMGMFYPFVHDEEVALYGVEAAGKGVHTEQHAATLTKGSVGVLHGSMMYLLQNEEGQIQE
AHSISAGLDYPGVGPEHSLLKDIGRVSYHSITDDEALEAFQLLTKKEGIIPALESSHAVA
YALKLAAQMKKDEGLVICLSGRGDKDVESIKRYMEEV
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaattacgcatatccagatgaaaaaggtcactacggtatatacggaggacgatacgtt
ccagaaacgttaatgcaatctgtattagaactagaagaagcatataaagaggcgatggaa
gatgaagcatttcaaaaggaattaaatcattatttaaaaacgtacgtcggaagagaaaca
ccgctatattatgctgaaaatatgacgaagtattgcggcggtgcaaaaatttatttaaaa
cgtgaagatttgaaccatacaggagctcataaaattaacaatacaattggtcaggcactt
cttgcagtaagaatgggtaagaaaaaagttgtcgctgaaacaggggctggacaacacgga
gtcgcaacagctactgtatgtgcccttctcggattagaatgcgtcatttttatgggagaa
gaagatgtaagacgtcaaaaattaaatgtgttccgaatggaattactcggagcgaaagta
gaaagtgtggcggcaggtagcggtacattaaaagatgcggtaaacgaggcgcttcgttac
tgggtttcacatgtgcatgatacgcactacattatgggatctgttcttggaccacatcca
ttcccacaaattgtccgtgatttccaaagtgtaattgggaaagaaacgaaaaaacaatat
gaagcgttagaaggaaagttaccagaagctgttgttgcttgtattggtggtggtagtaat
gcgatgggaatgttttatccgttcgtgcatgatgaagaagttgctctttacggcgtagaa
gcagctggaaaaggagttcatacagaacagcatgcagctactttaacgaaaggaagcgtt
ggcgttctccacggatcgatgatgtaccttctgcaaaatgaagaaggacaaattcaagaa
gctcactctatttcagctggacttgattacccgggggttggtccagaacatagtttacta
aaagatattggccgcgtttcttatcattccattactgatgatgaagcgttagaagcgttt
caattattaacgaaaaaagaaggaattatcccggcgttagaaagctcgcatgctgtcgca
tatgcattaaaattagcggcgcaaatgaagaaagacgaagggcttgtcatttgtttatct
ggccgtggtgataaagatgtagagagtataaaacgttatatggaagaggtgtaa

DBGET integrated database retrieval system